NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F051936

Metagenome Family F051936

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051936
Family Type Metagenome
Number of Sequences 143
Average Sequence Length 50 residues
Representative Sequence TGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFAMLIIRYLSIHISIKK
Number of Associated Samples 127
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 68.53 %
% of genes from short scaffolds (< 2000 bps) 27.27 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.706 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal
(39.161 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal distal gut
(51.049 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.06%    β-sheet: 0.00%    Coil/Unstructured: 52.94%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 143 Family Scaffolds
PF12728HTH_17 6.99
PF13589HATPase_c_3 3.50
PF00145DNA_methylase 3.50
PF01402RHH_1 3.50
PF09357RteC 2.80
PF00005ABC_tran 2.80
PF11066DUF2867 2.10
PF12724Flavodoxin_5 2.10
PF13102Phage_int_SAM_5 2.10
PF13304AAA_21 2.10
PF12992DUF3876 1.40
PF12833HTH_18 1.40
PF01637ATPase_2 1.40
PF09954DUF2188 1.40
PF01381HTH_3 1.40
PF00589Phage_integrase 1.40
PF02086MethyltransfD12 1.40
PF07715Plug 1.40
PF01555N6_N4_Mtase 1.40
PF16344DUF4974 0.70
PF00004AAA 0.70
PF01076Mob_Pre 0.70
PF02535Zip 0.70
PF01261AP_endonuc_2 0.70
PF03577Peptidase_C69 0.70
PF01872RibD_C 0.70
PF05552TM_helix 0.70
PF08291Peptidase_M15_3 0.70
PF08937DUF1863 0.70
PF01507PAPS_reduct 0.70
PF13437HlyD_3 0.70
PF06250YhcG_C 0.70
PF08447PAS_3 0.70
PF14310Fn3-like 0.70
PF02733Dak1 0.70
PF01844HNH 0.70
PF06114Peptidase_M78 0.70
PF04002RadC 0.70
PF01230HIT 0.70
PF01746tRNA_m1G_MT 0.70
PF00912Transgly 0.70
PF00873ACR_tran 0.70
PF14350Beta_protein 0.70
PF14322SusD-like_3 0.70
PF02384N6_Mtase 0.70
PF00275EPSP_synthase 0.70
PF09509Hypoth_Ymh 0.70
PF02472ExbD 0.70
PF00440TetR_N 0.70
PF14457Prok-E2_A 0.70
PF14253AbiH 0.70
PF03279Lip_A_acyltrans 0.70
PF04288MukE 0.70
PF02954HTH_8 0.70
PF028262-Hacid_dh_C 0.70
PF13588HSDR_N_2 0.70
PF03727Hexokinase_2 0.70
PF04072LCM 0.70
PF13419HAD_2 0.70
PF01850PIN 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 143 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 3.50
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 1.40
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 1.40
COG3392Adenine-specific DNA methylaseReplication, recombination and repair [L] 1.40
COG1672Predicted ATPase, archaeal AAA+ ATPase superfamilyGeneral function prediction only [R] 1.40
COG1373Predicted ATPase, AAA+ superfamilyGeneral function prediction only [R] 1.40
COG0863DNA modification methylaseReplication, recombination and repair [L] 1.40
COG0338DNA-adenine methylaseReplication, recombination and repair [L] 1.40
COG4804Predicted nuclease of restriction endonuclease-like (RecB) superfamily, DUF1016 familyGeneral function prediction only [R] 0.70
COG5026HexokinaseCarbohydrate transport and metabolism [G] 0.70
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.70
COG4690DipeptidaseAmino acid transport and metabolism [E] 0.70
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.70
COG4261Predicted acyltransferase, LPLAT superfamilyGeneral function prediction only [R] 0.70
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.70
COG3315O-Methyltransferase involved in polyketide biosynthesisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.70
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 0.70
COG3095Chromosome condensin MukBEF, MukE localization factorCell cycle control, cell division, chromosome partitioning [D] 0.70
COG2376Dihydroxyacetone kinaseCarbohydrate transport and metabolism [G] 0.70
COG2003DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motifReplication, recombination and repair [L] 0.70
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.70
COG1560Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis)Lipid transport and metabolism [I] 0.70
COG0848Biopolymer transport protein ExbDIntracellular trafficking, secretion, and vesicular transport [U] 0.70
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.70
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.70
COG0428Zinc transporter ZupTInorganic ion transport and metabolism [P] 0.70


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.71 %
UnclassifiedrootN/A6.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2065487000|bke_il_velvet_contig_87119All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.1206Open in IMG/M
2149837021|STU__NODE_11423_len_5933_cov_49_790493All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales5991Open in IMG/M
2149837021|STU__NODE_4677_len_5736_cov_74_025108Not Available5794Open in IMG/M
2149837021|STU__NODE_6906_len_2191_cov_28_485167All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides2249Open in IMG/M
2149837023|STU__NODE_12303_len_8591_cov_47_342567All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Kordia → Kordia algicida8649Open in IMG/M
3300000279|EM219_1000610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → Parabacteroides distasonis281170Open in IMG/M
3300000285|EM251_1015154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides6744Open in IMG/M
3300000289|EM283_1024862Not Available777Open in IMG/M
3300000298|EM350_1014510All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron108845Open in IMG/M
3300003155|Ga0052270_10308069All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium UC5.1-2G113072Open in IMG/M
3300005461|Ga0073906_1047255All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1635Open in IMG/M
3300005469|Ga0073907_1135158Not Available562Open in IMG/M
3300006463|Ga0100176_1000108All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis101576Open in IMG/M
3300006463|Ga0100176_1012026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides2635Open in IMG/M
3300006487|Ga0100256_10979All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp. 3_2_56581Open in IMG/M
3300006502|Ga0100528_100238All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis94701Open in IMG/M
3300006525|Ga0101027_104343All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Pedobacter → Pedobacter nutrimenti6646Open in IMG/M
3300006525|Ga0101027_114142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp. AR202063Open in IMG/M
3300006722|Ga0101786_101104All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis5466Open in IMG/M
3300007098|Ga0102540_100480All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales30265Open in IMG/M
3300007109|Ga0102633_104538All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.4976Open in IMG/M
3300007288|Ga0104346_100006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron306767Open in IMG/M
3300007298|Ga0104838_102862All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis7462Open in IMG/M
3300007299|Ga0104319_1000031All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides intestinalis195840Open in IMG/M
3300007305|Ga0104872_101604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides17602Open in IMG/M
3300007353|Ga0104758_100065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides nordii171871Open in IMG/M
3300007524|Ga0105481_1005386All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. D264532Open in IMG/M
3300007524|Ga0105481_1036052All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia821Open in IMG/M
3300007641|Ga0105527_100105All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides116246Open in IMG/M
3300007664|Ga0105542_1004822All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp. 2_2_45717Open in IMG/M
3300007793|Ga0105888_104993All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis5402Open in IMG/M
3300007797|Ga0105663_110145All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.2009Open in IMG/M
3300007853|Ga0114093_100382All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron61477Open in IMG/M
3300007853|Ga0114093_100529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis45937Open in IMG/M
3300008063|Ga0113867_100164All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides cellulosilyticus122026Open in IMG/M
3300008063|Ga0113867_103981All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae4488Open in IMG/M
3300008071|Ga0110933_1031854All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia1395Open in IMG/M
3300008077|Ga0105964_1007083All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides stercorirosoris3821Open in IMG/M
3300008079|Ga0105956_103107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Sanguibacteroides → Sanguibacteroides justesenii5236Open in IMG/M
3300008079|Ga0105956_115924All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → Parabacteroides johnsonii931Open in IMG/M
3300008081|Ga0113559_104822All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides oleiciplenus6595Open in IMG/M
3300008146|Ga0114360_10001718All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides xylanisolvens4094Open in IMG/M
3300008404|Ga0115185_102607All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron7741Open in IMG/M
3300008455|Ga0115313_101701All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. D265979Open in IMG/M
3300008455|Ga0115313_101863All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis5489Open in IMG/M
3300008478|Ga0114882_111440All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis1254Open in IMG/M
3300008513|Ga0111022_100006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis298705Open in IMG/M
3300008513|Ga0111022_120014Not Available628Open in IMG/M
3300008520|Ga0111044_113630Not Available1881Open in IMG/M
3300008619|Ga0111235_102340All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis4509Open in IMG/M
3300008619|Ga0111235_105301All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1636Open in IMG/M
3300008676|Ga0111520_100133All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron118059Open in IMG/M
3300008676|Ga0111520_103461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron3299Open in IMG/M
3300008716|Ga0113874_104908All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis3909Open in IMG/M
3300008728|Ga0115675_100291All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron75210Open in IMG/M
3300008744|Ga0114025_1039796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia823Open in IMG/M
3300008750|Ga0114087_118215Not Available706Open in IMG/M
3300010262|Ga0129317_1023540All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis1260Open in IMG/M
3300010262|Ga0129317_1048658Not Available699Open in IMG/M
3300014516|Ga0169883_102824All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1347Open in IMG/M
3300014525|Ga0169871_100462All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides31484Open in IMG/M
3300014543|Ga0169722_103258All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. D264807Open in IMG/M
3300014754|Ga0134378_100605All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. 20_318302Open in IMG/M
3300014767|Ga0134506_100452All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales16736Open in IMG/M
3300014769|Ga0134404_110120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1251Open in IMG/M
3300014802|Ga0134374_1019974All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → Parabacteroides distasonis957Open in IMG/M
3300014824|Ga0134492_1036965All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1590Open in IMG/M
3300014935|Ga0169825_100075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides138638Open in IMG/M
3300014956|Ga0134434_1008414All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales2069Open in IMG/M
3300014963|Ga0134523_1007753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides xylanisolvens9431Open in IMG/M
3300023494|Ga0257057_104120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis4623Open in IMG/M
3300023495|Ga0257060_10100All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Phocaeicola → Phocaeicola dorei134072Open in IMG/M
3300023717|Ga0257029_12265All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides6521Open in IMG/M
3300028965|Ga0169695_100102All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → Parabacteroides goldsteinii86481Open in IMG/M
3300028991|Ga0169632_104766All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → Parabacteroides distasonis1100Open in IMG/M
3300029004|Ga0169688_100048All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron134121Open in IMG/M
3300029013|Ga0169598_102816All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides5227Open in IMG/M
3300029033|Ga0169717_104259All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia4887Open in IMG/M
3300029037|Ga0169705_100011All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Phocaeicola → Phocaeicola massiliensis213621Open in IMG/M
3300029081|Ga0169209_100093All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron137321Open in IMG/M
3300029097|Ga0169217_106304All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides nordii1758Open in IMG/M
3300029137|Ga0168731_100171All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides93432Open in IMG/M
3300029137|Ga0168731_101450All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales12670Open in IMG/M
3300029207|Ga0168683_104026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → Parabacteroides johnsonii4617Open in IMG/M
3300029208|Ga0168729_103505All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis5807Open in IMG/M
3300029214|Ga0168682_115657All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1104Open in IMG/M
3300029227|Ga0168687_113163All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1449Open in IMG/M
3300029238|Ga0168766_128305All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides salyersiae839Open in IMG/M
3300029257|Ga0168675_104315All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides xylanisolvens5183Open in IMG/M
3300029329|Ga0242807_102395All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides xylanisolvens14998Open in IMG/M
3300029361|Ga0243815_1002226All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia15373Open in IMG/M
3300029423|Ga0243802_132918All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides721Open in IMG/M
3300029427|Ga0243889_1033107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides945Open in IMG/M
3300029474|Ga0244136_105559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales4220Open in IMG/M
3300029476|Ga0244146_102216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales9744Open in IMG/M
3300029479|Ga0244137_101744All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides11627Open in IMG/M
3300029482|Ga0244120_103034All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Phocaeicola → Phocaeicola vulgatus6857Open in IMG/M
3300029490|Ga0244171_100146All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides122441Open in IMG/M
3300029507|Ga0244816_100181All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis107943Open in IMG/M
3300029507|Ga0244816_100436All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides47620Open in IMG/M
3300029511|Ga0244809_122366All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. D26777Open in IMG/M
3300029513|Ga0244810_102156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides9988Open in IMG/M
3300029514|Ga0244787_101611All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides11600Open in IMG/M
3300029516|Ga0244799_102295All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia14058Open in IMG/M
3300029520|Ga0244801_101158All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides25174Open in IMG/M
3300029520|Ga0244801_136898Not Available670Open in IMG/M
3300029521|Ga0244833_102173All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides salyersiae13954Open in IMG/M
3300029523|Ga0244821_101927All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales12724Open in IMG/M
3300029524|Ga0244794_113098All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis2421Open in IMG/M
3300029550|Ga0245019_104114All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium UC5.1-2G113156Open in IMG/M
3300029564|Ga0244919_104572All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia4504Open in IMG/M
3300029566|Ga0244934_118553All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. 20_31644Open in IMG/M
3300029577|Ga0244883_105154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides7038Open in IMG/M
3300029583|Ga0245123_107959All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides xylanisolvens4200Open in IMG/M
3300029592|Ga0245129_101734All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron11735Open in IMG/M
3300029594|Ga0245142_102638All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales7934Open in IMG/M
3300029605|Ga0245145_103002All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides11972Open in IMG/M
3300029618|Ga0245134_100593All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides49942Open in IMG/M
3300029665|Ga0243765_100030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis205713Open in IMG/M
3300029672|Ga0243361_108928All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides1996Open in IMG/M
3300029686|Ga0245204_104974All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → Parabacteroides gordonii4726Open in IMG/M
3300029708|Ga0245189_101560All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales21916Open in IMG/M
3300029722|Ga0245188_121487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides597Open in IMG/M
3300029727|Ga0245198_100378All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → Parabacteroides johnsonii71626Open in IMG/M
3300029749|Ga0245202_1020285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1883Open in IMG/M
3300029759|Ga0243843_113694All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1455Open in IMG/M
3300029767|Ga0243804_102871All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales10033Open in IMG/M
3300029770|Ga0168716_151765Not Available535Open in IMG/M
3300029815|Ga0244882_1000714All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides47501Open in IMG/M
3300029819|Ga0245024_102058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales12298Open in IMG/M
3300029848|Ga0245285_1002629All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides xylanisolvens10922Open in IMG/M
3300029860|Ga0245305_1034618All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales985Open in IMG/M
3300029862|Ga0245308_124628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis1095Open in IMG/M
3300029871|Ga0245314_100027All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides277333Open in IMG/M
3300029878|Ga0245327_107343All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides neonati3339Open in IMG/M
3300029881|Ga0245307_1000270All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis103801Open in IMG/M
3300029886|Ga0245330_108651All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1730Open in IMG/M
7000000069|SRS016095_WUGC_scaffold_35323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1136Open in IMG/M
7000000111|C2051319All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides cellulosilyticus4922Open in IMG/M
7000000145|SRS050422_LANL_scaffold_24882All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides12786Open in IMG/M
7000000213|SRS011405_WUGC_scaffold_11236All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides intestinalis21342Open in IMG/M
7000000492|SRS048164_WUGC_scaffold_24306All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides659Open in IMG/M
7000000570|SRS051882_Baylor_scaffold_8753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides caccae5157Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Human FecalHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal39.16%
HumanHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human34.97%
Human Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated8.39%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated6.29%
Human FecesHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces4.90%
Human GutHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut2.10%
Eastern Black-And-White Colobus Group FecalHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Eastern Black-And-White Colobus Group Fecal1.40%
Mouse CecumHost-Associated → Mammals → Digestive System → Large Intestine → Cecum → Mouse Cecum1.40%
Broiler Chicken CecumHost-Associated → Birds → Digestive System → Ceca → Lumen → Broiler Chicken Cecum0.70%
WastewaterEngineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2065487000Human fecal microbial communities from Baylor School of Medicine, Texas, USA, mock community - bke_il_velvetHost-AssociatedOpen in IMG/M
2149837021Human fecal microbial communities from the University of Arizona (HMP) - UAf1Host-AssociatedOpen in IMG/M
2149837023Human fecal microbial communities from the University of Arizona (HMP) - UAm1Host-AssociatedOpen in IMG/M
3300000279Human fecal microbial communities from Cork, Ireland - EM219Host-AssociatedOpen in IMG/M
3300000285Human fecal microbial communities from Cork, Ireland - EM251Host-AssociatedOpen in IMG/M
3300000289Human fecal microbial communities from Cork, Ireland - EM283Host-AssociatedOpen in IMG/M
3300000298Human fecal microbial communities from Cork, Ireland - EM350Host-AssociatedOpen in IMG/M
3300003155Broiler Chicken cecum microbial communities from the University of Birmingham, UKHost-AssociatedOpen in IMG/M
3300005461Mouse cecum microbial communities from Vienna, Austria - Inoculum for glucosamine and mucus D2O microcosmsHost-AssociatedOpen in IMG/M
3300005469Mouse cecum microbial communities from Vienna, Austria - Glucosamine amended microcosms incubated with D2OHost-AssociatedOpen in IMG/M
3300006463Human stool microbial communities from NIH, USA - visit 2 of subject 159207311Host-AssociatedOpen in IMG/M
3300006487Human stool microbial communities from NIH, USA - visit 1, subject 159591683Host-AssociatedOpen in IMG/M
3300006502Human stool microbial communities from NIH, USA - visit 1, subject 764588959Host-AssociatedOpen in IMG/M
3300006525Human stool microbial communities from NIH, USA - visit 2, subject 764062976Host-AssociatedOpen in IMG/M
3300006722Human stool microbial communities from NIH, USA - visit 2, subject 686765762Host-AssociatedOpen in IMG/M
3300007098Human stool microbial communities from NIH, USA - visit 1, subject 765135172Host-AssociatedOpen in IMG/M
3300007109Human stool microbial communities from NIH, USA - visit 1, subject 765620695Host-AssociatedOpen in IMG/M
3300007288Human stool microbial communities from NIH, USA - visit 1, subject 159510762 reassemblyHost-AssociatedOpen in IMG/M
3300007298Human stool microbial communities from NIH, USA - visit 1, subject 160603188 reassemblyHost-AssociatedOpen in IMG/M
3300007299Human stool microbial communities from NIH, USA - visit 1, subject 160765029 reassemblyHost-AssociatedOpen in IMG/M
3300007305Human stool microbial communities from NIH, USA - visit 2, subject 158802708 reassemblyHost-AssociatedOpen in IMG/M
3300007353Human stool microbial communities from NIH, USA - visit 1, subject 765013792 reassemblyHost-AssociatedOpen in IMG/M
3300007524Human stool microbial communities from NIH, USA - visit 1, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300007641Human stool microbial communities from NIH, USA - visit number 3 of subject 159227541 reassemblyHost-AssociatedOpen in IMG/M
3300007664Human stool microbial communities from NIH, USA - visit 1, subject 765074482 reassemblyHost-AssociatedOpen in IMG/M
3300007793Human stool microbial communities from NIH, USA - visit 2, subject 763860675 reassemblyHost-AssociatedOpen in IMG/M
3300007797Human stool microbial communities from NIH, USA - visit 2, subject 764325968 reassemblyHost-AssociatedOpen in IMG/M
3300007853Human stool microbial communities from NIH, USA - visit 1, subject 765560005 reassemblyHost-AssociatedOpen in IMG/M
3300008063Human stool microbial communities from NIH, USA - visit 1, subject 764447348 reassemblyHost-AssociatedOpen in IMG/M
3300008071Wastewater microbial communities from the domestic sewers in Singapore - Site 1EngineeredOpen in IMG/M
3300008077Human stool microbial communities from NIH, USA - visit 1, subject 763860675 reassemblyHost-AssociatedOpen in IMG/M
3300008079Human stool microbial communities from NIH, USA - visit 1, subject 160582958 reassemblyHost-AssociatedOpen in IMG/M
3300008081Human stool microbial communities from NIH, USA - visit 2, subject 765074482 replicate 1 reassemblyHost-AssociatedOpen in IMG/M
3300008146Human stool microbial communities from NIH, USA - visit 2, subject 604812005 SPADES reassemblyHost-AssociatedOpen in IMG/M
3300008404Human stool microbial communities from NIH, USA - visit 2, subject 764002286 reassemblyHost-AssociatedOpen in IMG/M
3300008455Human stool microbial communities from NIH, USA - visit 1, subject 686765762 reassemblyHost-AssociatedOpen in IMG/M
3300008478Human stool microbial communities from NIH, USA - visit 2, subject 763982056 reassemblyHost-AssociatedOpen in IMG/M
3300008513Human stool microbial communities from NIH, USA - visit 1, subject 160319967 reassemblyHost-AssociatedOpen in IMG/M
3300008520Human stool microbial communities from NIH, USA - visit 1, subject 764487809 reassemblyHost-AssociatedOpen in IMG/M
3300008619Human stool microbial communities from NIH, USA - visit 1, subject 159369152 reassemblyHost-AssociatedOpen in IMG/M
3300008676Human stool microbial communities from NIH, USA - visit number 3 of subject 159753524 reassemblyHost-AssociatedOpen in IMG/M
3300008716Human stool microbial communities from NIH, USA - visit 1, subject 861967750 reassemblyHost-AssociatedOpen in IMG/M
3300008728Human stool microbial communities from NIH, USA - visit 2, subject 763840445 reassemblyHost-AssociatedOpen in IMG/M
3300008744Human stool microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300008750Human stool microbial communities from NIH, USA - visit 2, subject 159005010 reassemblyHost-AssociatedOpen in IMG/M
3300010262Eastern black-and-white colobus group fecal microbial communities from Wisconsin, USA - Cm1105 metagenomeHost-AssociatedOpen in IMG/M
3300014516Human fecal microbial communities from newborn in Denmark - 82_BHost-AssociatedOpen in IMG/M
3300014525Human fecal microbial communities from newborn in Denmark - 70_BHost-AssociatedOpen in IMG/M
3300014543Human fecal microbial communities from infant at 12 months in Denmark - 511_12MHost-AssociatedOpen in IMG/M
3300014754Human fecal microbial communities from obese patients in Germany - AS50_0Host-AssociatedOpen in IMG/M
3300014767Human fecal microbial communities from ulcerative colitis therapy, University of Washington - UWIBD01P788T1Host-AssociatedOpen in IMG/M
3300014769Human fecal microbial communities from obese patients in Germany - AS43_18Host-AssociatedOpen in IMG/M
3300014802Human fecal microbial communities from obese patients in Germany - AS66_24Host-AssociatedOpen in IMG/M
3300014824Human fecal microbial communities from ulcerative colitis therapy, University of Washington - UWIBD01P279T2Host-AssociatedOpen in IMG/M
3300014935Human fecal microbial communities from infant at 12 months in Denmark - 598_12MHost-AssociatedOpen in IMG/M
3300014956Human fecal microbial communities from obese patients in Germany - AS50_3Host-AssociatedOpen in IMG/M
3300014963Human fecal microbial communities from elderly subjects during probiotic consumption in Boston, USA - meta_42827d56Host-AssociatedOpen in IMG/M
3300023494Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_85AHost-AssociatedOpen in IMG/M
3300023495Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_77CHost-AssociatedOpen in IMG/M
3300023717Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_128BHost-AssociatedOpen in IMG/M
3300028965Human fecal microbial communities from infant at 4 months in Denmark - 39_4MHost-AssociatedOpen in IMG/M
3300028991Human fecal microbial communities from newborn in Denmark - 281_BHost-AssociatedOpen in IMG/M
3300029004Human fecal microbial communities from infant at 12 months in Denmark - 387_12MHost-AssociatedOpen in IMG/M
3300029013Human fecal microbial communities from infant at 12 months in Denmark - 26_12MHost-AssociatedOpen in IMG/M
3300029033Human fecal microbial communities from mother in Denmark - 504_MHost-AssociatedOpen in IMG/M
3300029037Human fecal microbial communities from mother in Denmark - 42_MHost-AssociatedOpen in IMG/M
3300029081Human fecal microbial communities from infant at 12 months in Denmark - 157_12MHost-AssociatedOpen in IMG/M
3300029097Human fecal microbial communities from infant at 12 months in Denmark - 179_12MHost-AssociatedOpen in IMG/M
3300029137Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI012075-46Host-AssociatedOpen in IMG/M
3300029207Human fecal microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002666-35Host-AssociatedOpen in IMG/M
3300029208Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI012073-44Host-AssociatedOpen in IMG/M
3300029214Human fecal microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002665-34Host-AssociatedOpen in IMG/M
3300029227Human fecal microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002670-43Host-AssociatedOpen in IMG/M
3300029238Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI019821-26Host-AssociatedOpen in IMG/M
3300029257Human fecal microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002658-45Host-AssociatedOpen in IMG/M
3300029329Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 009_6_30_stool_1Host-AssociatedOpen in IMG/M
3300029361Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 046_3_10_stool_1Host-AssociatedOpen in IMG/M
3300029423Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_30_stool_2Host-AssociatedOpen in IMG/M
3300029427Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 074_4_29_stool_2Host-AssociatedOpen in IMG/M
3300029474Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001893-50Host-AssociatedOpen in IMG/M
3300029476Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001904-94Host-AssociatedOpen in IMG/M
3300029479Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001894-56Host-AssociatedOpen in IMG/M
3300029482Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001875-22Host-AssociatedOpen in IMG/M
3300029490Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001929-16Host-AssociatedOpen in IMG/M
3300029507Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005383-51Host-AssociatedOpen in IMG/M
3300029511Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005376-42Host-AssociatedOpen in IMG/M
3300029513Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005377-43Host-AssociatedOpen in IMG/M
3300029514Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI003283-119Host-AssociatedOpen in IMG/M
3300029516Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005366-25Host-AssociatedOpen in IMG/M
3300029520Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005368-32Host-AssociatedOpen in IMG/M
3300029521Human fecal microbial communities from Shanghai Jiao Tong University, China - SZAXPI012168-57Host-AssociatedOpen in IMG/M
3300029523Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005388-57Host-AssociatedOpen in IMG/M
3300029524Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005361-17Host-AssociatedOpen in IMG/M
3300029550Human fecal microbial communities from Shanghai, China - P101V1Host-AssociatedOpen in IMG/M
3300029564Human fecal microbial communities from Shanghai, China - P033V1Host-AssociatedOpen in IMG/M
3300029566Human fecal microbial communities from Shanghai, China - P040V6Host-AssociatedOpen in IMG/M
3300029577Human fecal microbial communities from Shanghai, China - P012V1Host-AssociatedOpen in IMG/M
3300029583Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35723Host-AssociatedOpen in IMG/M
3300029592Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35979Host-AssociatedOpen in IMG/M
3300029594Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36116Host-AssociatedOpen in IMG/M
3300029605Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36211Host-AssociatedOpen in IMG/M
3300029618Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36006Host-AssociatedOpen in IMG/M
3300029665Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 038_10_27_stool_2Host-AssociatedOpen in IMG/M
3300029672Human fecal microbial communities from liver cirrhosis patients in Hangzhou, China - LD-47_Run3Host-AssociatedOpen in IMG/M
3300029686Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37305R1Host-AssociatedOpen in IMG/M
3300029708Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37210Host-AssociatedOpen in IMG/M
3300029722Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37206Host-AssociatedOpen in IMG/M
3300029727Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37283Host-AssociatedOpen in IMG/M
3300029749Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37299R1Host-AssociatedOpen in IMG/M
3300029759Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 050_3_11_stool_1Host-AssociatedOpen in IMG/M
3300029767Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_31_stool_2Host-AssociatedOpen in IMG/M
3300029770Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI012060-26Host-AssociatedOpen in IMG/M
3300029815Human fecal microbial communities from Shanghai, China - P010V6Host-AssociatedOpen in IMG/M
3300029819Human fecal microbial communities from Shanghai, China - P103V6Host-AssociatedOpen in IMG/M
3300029848Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37133Host-AssociatedOpen in IMG/M
3300029860Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37337Host-AssociatedOpen in IMG/M
3300029862Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37353Host-AssociatedOpen in IMG/M
3300029871Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37545Host-AssociatedOpen in IMG/M
3300029878Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35366Host-AssociatedOpen in IMG/M
3300029881Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37349Host-AssociatedOpen in IMG/M
3300029886Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35724Host-AssociatedOpen in IMG/M
7000000069Human stool microbial communities from NIH, USA - visit 1, subject 764588959Host-AssociatedOpen in IMG/M
7000000111Human stool microbial communities from NIH, USA - visit 1, subject 765620695Host-AssociatedOpen in IMG/M
7000000145Human stool microbial communities from NIH, USA - visit 2, subject 763536994Host-AssociatedOpen in IMG/M
7000000213Human stool microbial communities from NIH, USA - visit 1, subject 159247771Host-AssociatedOpen in IMG/M
7000000492Human stool microbial communities from NIH, USA - visit 1, subject 861967750Host-AssociatedOpen in IMG/M
7000000570Human stool microbial communities from NIH, USA - visit 2, subject 764143897Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
bke_il_velvet_010299302065487000Human FecalGQVLFFLLAPRGKAFGFSGLSETAVMTPVIINFSLLLIIR
STU_0846.000009502149837021Human FecalTGQVLFFPLALRGKAFGFRVLQEHAVMTPVISIFFAMLIIRHLSIHISIKK
STU_0483.000010502149837021Human FecalGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK
STU_0590.000017502149837021Human FecalKAFGFSVLQEHAVMTPVISTSVTMLIIRRLSIYISIKK
STU_0457.000018502149837023Human FecalGFSVLQEHAVMTLVISIFFATLIIRYLSIHISIKK
EM219_10006102433300000279Human FecalMKQEGTGQVLFFLLALRGKAFGFSGLSETAVMTPVIINFSLLLIIR*
EM251_101515463300000285Human FecalAFGFSVLQEHAVMTPVINIFFAVLIIRYLSIHISIKK*
EM283_102486213300000289Human FecalFPLALRGKAFGFSVLQEHTVMTPVISIFFATLIIRYLSIHISIKK*
EM350_1014510753300000298Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLSIHISIKK*
Ga0052270_1030806943300003155Broiler Chicken CecumMKQEGTGLCPVLPLALRGKAFGFSVLQEHAVMTLVISIFFATLIIRYLSIHISIKK*
Ga0073906_104725513300005461Mouse CecumEQEGTGQVLFFPLALRGKAFGFNMLQEHAVMTPAISISFKTLIIKYLSIYISIKK*
Ga0073907_113515823300005469Mouse CecumQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK*
Ga0100176_100010813300006463HumanTLFRSIEQEGTGQVLFFPLALRGKAFGFRVLQEHVVMTPVISIFFSTLIIRYLSIYISIKK*
Ga0100176_101202613300006463HumanFRSQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVIRISFSMLIIRHL*
Ga0100256_1097913300006487HumanLRGKAFGFSVLQEHAVMTPVISIFFAVLIIRYLSIHISIKK*
Ga0100528_100238863300006502HumanQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISISKKMLIVRHLSIHIYIKK*
Ga0101027_10434313300006525HumanLLFAPLALRGKAFGFSVLQEHTVMTPVISVFFAMLIIRYLSIHISIKK*
Ga0101027_11414213300006525HumanVLFFPLALRGKAFGFSVLQEHAVMTPIINILFAMLIIRYLSIHISTKK*
Ga0101786_10110463300006722HumanKAFGFSVLQKHAVMTPVISIFFEMLIIRYLYIHISIKK*
Ga0102540_100480213300007098HumanMKQEGTGQVLFFLLAPRGKAFGFSGLSETAVMTPVIINFSLLLIIR*
Ga0102633_10453853300007109HumanTGQVLFFPLALRGKAFGFSVLREHAVMTPVISIFFSMLIIRYLSIHISIKK*
Ga0104346_1000061433300007288HumanMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVIIIFFATLIIRYLSIHISIKK*
Ga0104838_10286273300007298HumanVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK*
Ga0104319_10000311473300007299HumanVPLALRGKAFGFSVLQEHAVMTPVISIFFVMLVIRYLSIHISIKK*
Ga0104872_101604173300007305HumanEQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK*
Ga0104758_1000651363300007353HumanGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK*
Ga0105481_100538613300007524HumanVLFFPLALRGKAFGFSVLQEHAVMTPIISIFFVMLIIRYLSIHISIKK*
Ga0105481_103605213300007524HumanVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFATLIIKYLYIHISIKSNYHAQ*
Ga0105527_100105113300007641HumanMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK*
Ga0105542_100482213300007664HumanGKAFGFSVLQEHAVMTPVISIFFATLIIKYLYIHISIKSNYHAQ*
Ga0105888_10499393300007793HumanMKQEGTGQVLFFPLALRGKALGFSVLQEHAVMTPVISIFFATLIIRYLSIHISIK
Ga0105663_11014513300007797HumanAFGFSVLQEHAVMTPVISIFFATLIIKYLYIHISIKSNYHAQ*
Ga0114093_10038213300007853HumanFFPLALRGKAFGFSVLQEHAVMTPVIIIFFATLIIRYLSIHISIKK*
Ga0114093_10052913300007853HumanFPLALRGKAFGFSVLQEHAVMTPVISIAKKVLIIRYLSIHISIKK*
Ga0113867_100164733300008063HumanIEQEGTGQVLFFPLALRGKAFGFSVLREHAVMTPVISIFFSMLIIRYLSIHISIKK*
Ga0113867_10398113300008063HumanFFPLALRGKAFGFSVLQEHAVMTPVISIFFVILIIRYLSIHIPIKK*
Ga0110933_103185433300008071WastewaterMEQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTLVISIFFATLIIRYLSIHISIKK*
Ga0105964_100708363300008077HumanFCPLARRGKALGFSVLQEHAVMTPVISIFFATLIIKYLSIHISIKK*
Ga0105956_10310763300008079HumanALRGKAFGFSVLQEHAVMTPVISIFFAILIIRYLSIHISIKK*
Ga0105956_11592433300008079HumanFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK*
Ga0113559_10482213300008081HumanGKAFGFSVLQEHAVMTPVISIFFTMPIIRYLSIHISIKK*
Ga0114360_1000171823300008146HumanMEQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFETLIIKYLSIQISIKK*
Ga0115185_10260713300008404HumanQGGTVQVLFFPLALRGKAFGFSVLQEHAVMTPIINIFFVTLIIRYLSIHISIKK*
Ga0115313_10170173300008455HumanETGQVLFSPLALRGKAFGFSVLQEHAVMTPIISIFFVMLIIRYLSIHISIKK*
Ga0115313_10186313300008455HumanEQVLFFPLALRGKAFGFSVLQKHAVMTPVISIFFEMLIIRYLYIHISIKK*
Ga0114882_11144013300008478HumanQEGTGQVLFFPLALRGKAFGFSVLQEYAVMTSVITIFFLMVIIRDLSIHISIKK*
Ga0111022_1000061053300008513HumanMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISISFSMLIVRYLSIHISIKK*
Ga0111022_12001413300008513HumanPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK*
Ga0111044_11363043300008520HumanKQEGTGQVLFFLLALRGKAFGFSGLSETAVMTPVIINFSLLLIIR*
Ga0111235_10234063300008619HumanPLALRGKAFGFSVLQEHAVMTPVISIAKKVLIIRYLSIHISIKK*
Ga0111235_10530133300008619HumanPLALRGKAFGFSVLQEHAVMTPVISIFFEILIIRYLSIHISIKK*
Ga0111520_100133723300008676HumanFPLALRGKAFGFSVLQEHAVMTPVISIFFATLIIKYLSIHISIKK*
Ga0111520_10346113300008676HumanQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLSIHISIKK*
Ga0113874_10490853300008716HumanIEQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTPVISIFFEMLIIRYLYIHISIKK*
Ga0115675_10029173300008728HumanMKQEGTGQVLFFPLALRGKALGFSVLQEHAVMIPVISIFFATLIIRYLSIHISIKK*
Ga0114025_103979623300008744HumanFPLALRGKAFGFSVLQEHAVMTPVISIFFATLIIKYLYIHISIKSNYHAQ*
Ga0114087_11821523300008750HumanMKQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYL
Ga0129317_102354013300010262Eastern Black-And-White Colobus Group FecalQVLFFPLALRGKAFGFSVLQENAVMTPVISIFFVMLMIRYLSIHISIKK*
Ga0129317_104865823300010262Eastern Black-And-White Colobus Group FecalQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFETLIIKYLSIQISIKK*
Ga0169883_10282413300014516Human Host-AssociatedEGTGQVLFFLLALRGKAFGFSVLQEHAVMTPVISIFFATLIIRYLSIHISIKK*
Ga0169871_10046273300014525Human Host-AssociatedMKQEGTGQVLFFPLALRGKALGFSVLQEHAVMTPVISIFFATLIIKYLSIHISIKK*
Ga0169722_10325873300014543Human Host-AssociatedTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFAMLIIRYLSIHISIKK*
Ga0134378_100605233300014754Human FecalMKQEGTGQVLFFPLALRGKAFGFSGLSETAVMTPVIINFSLLLIIR*
Ga0134506_100452183300014767Human FecalVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFSVLIITYLSIHISIKK*
Ga0134404_11012033300014769Human FecalPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLSIHISIKK*
Ga0134374_101997433300014802Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISISKKMLIVRHLSIHIYIKK*
Ga0134492_103696533300014824Human FecalEQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFLMLIIRYLSIHISIKK*
Ga0169825_100075223300014935Human Host-AssociatedMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMAPVISIFSAMLIIKHLSIHISIKK*
Ga0134434_100841413300014956Human FecalTGQVLFFPLALRGKAFGFSGLSETAVMTPVIINFSLLLIIR*
Ga0134523_1007753123300014963Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVTSIFFSRLIIRYLSIHISIKK*
Ga0257057_10412023300023494Human GutMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK
Ga0257060_10100193300023495Human GutMKQEGTGLCPVLPLALRGKAFGFSVLQEHAVMTLVISIFFATLIIRYLSIHISIKK
Ga0257029_1226513300023717Human GutTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRNLSIHISIKK
Ga0169695_100102153300028965Human Host-AssociatedMKQEGTGQVLFFPLALRGKAFGFSVLQKHAAMTPVISIAKKMLIIRYLSIHISIKK
Ga0169632_10476633300028991Human Host-AssociatedQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTPVISIFFAMLIIRYLSIHISIKK
Ga0169688_10004873300029004Human Host-AssociatedMKQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLSIHISIKK
Ga0169598_10281643300029013Human Host-AssociatedMKQEGTGQVLFFPLALRGKALGFSVLQEHAVMIPVISIFFATLIIRYLSIHISIKK
Ga0169717_10425973300029033Human Host-AssociatedGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVVLIIRHLSIHISIKK
Ga0169705_100011353300029037Human Host-AssociatedMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISISFLVLIIRYLSIHISMKK
Ga0169209_10009373300029081Human Host-AssociatedMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVIIIFFATLIIRYLSIHISIKK
Ga0169217_10630413300029097Human Host-AssociatedGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK
Ga0168731_100171603300029137Host-AssociatedMKQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTPAISIFFAMLIIRYLSIQISIKK
Ga0168731_10145063300029137Host-AssociatedMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFAILIIRYLSIHISIKK
Ga0168683_10402673300029207Host-AssociatedFFPLALRGKAFGFSVLQEHAVMTPVINIFFAMLIIRYLSIHISIKK
Ga0168729_10350513300029208Host-AssociatedLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK
Ga0168682_11565733300029214Host-AssociatedPLALRGKAFGFSVLQEHAVMTPVISIFFAMLIIRYLSIYISIKK
Ga0168687_11316333300029227Host-AssociatedLALRGKAFGFSVLQEHAVMTPVISIFILMVIIRYLSIHISIKK
Ga0168766_12830513300029238Host-AssociatedEQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK
Ga0168675_10431583300029257Host-AssociatedLRGKAFGFSVLQEHAVMTPVISIFFEILIIRYLSIQISIKK
Ga0242807_102395123300029329Human FecesMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVTSIFFSRLIIRYLSIHISIKK
Ga0243815_100222653300029361Human FecesMKQEGTGLCPVLPLALRGKAFGFSVLQEHAVMTLVISIFFTIPIIRYLSIHISIKK
Ga0243802_13291813300029423Human FecesMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVIIIFFATLIIRYLSIHISI
Ga0243889_103310733300029427Human FecesGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK
Ga0244136_10555953300029474Human FecalPLALRGKAFGFSVLQEHAVMTPVIRIFFVMLIVRYLSIHISIKK
Ga0244146_10221613300029476Human FecalGQVLFFPLALRGKAFGFSVLQEHAVITPVISISHSRFIIRHLSIHISIKK
Ga0244137_10174413300029479Human FecalQVLFFPLALRGKAFGFSVLQEHAVMAPVISIFSAMLIIKHLSIHISIKK
Ga0244120_10303413300029482Human FecalGFSVLQEHAVMTPVIRIFFVMLIVRYLSIHISIKK
Ga0244171_100146423300029490Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVIIIFFAMLIIRYLSIHISIKK
Ga0244816_10018113300029507Human FecalQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK
Ga0244816_100436333300029507Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISISFAMLIIRYLSIHISIKK
Ga0244809_12236613300029511Human FecalTGQVLFFPLALRGKAFGFSVLQEHAVMTPIISIFFVMLIIRYLSIHISIKK
Ga0244810_10215613300029513Human FecalEQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVIRISFSILIIRHL
Ga0244787_101611113300029514Human FecalMKQEGTGQVLFFPLALRGKALGFSVLQEHAVMTPVISIFFATLIIKYLSIHISIKXXXXXXXXQ
Ga0244799_10229563300029516Human FecalMKQEGTGLCPVLPLALRGKAFGFSVLQEHAVMTLVISIFFATLIIRYLSIXXXXXXXX
Ga0244801_10115813300029520Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQEYAVMTPVISISVTMLIIRRLSIYI
Ga0244801_13689823300029520Human FecalVLFFLLALRGKAFGFSGLSETAVMTPVIINFSLLLIIR
Ga0244833_10217313300029521Human FecalFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK
Ga0244821_10192773300029523Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQEYAVMTPVISISVTMLIIRRLSIYISIKK
Ga0244794_11309863300029524Human FecalLALRGKAFGFSVLQKHAVMTPVIILFFEMLIIRYLSIHISIKK
Ga0245019_10411433300029550Human FecalMKQEGTGLCPVLPLALRGKAFGFSVLQEHAVMTLVISIFFAMLIIRHLSIHISIKK
Ga0244919_10457213300029564Human FecalVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVVLIIRHLSIHISIKK
Ga0244934_11855333300029566Human FecalQVLFFLLALRGKAFGFSGLSETAVMTPVIINFSLLLIIR
Ga0244883_10515413300029577Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLS
Ga0245123_10795913300029583Human FecalALRGKAFGFSVLQEHAVMTPVISIFFEILIIRYLSIQISIKK
Ga0245129_10173413300029592Human FecalFFPLALRGKAFGFSVLQEHVVMTPVISIFFAILIIRYLSIHISIKK
Ga0245142_10263863300029594Human FecalEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFVAILIIRYLSIHISIKK
Ga0245145_103002133300029605Human FecalMKQEGTGQVLFFPLALRGNAFGFSVLQEHAVMTPIIIISALMLIIRYLYIHISIKK
Ga0245134_100593303300029618Human FecalMEQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRHLSIHISIKK
Ga0243765_100030743300029665Human FecesMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISISFSMLIVRYLSIHISIKK
Ga0243361_10892813300029672Human FecalMKQEGTGQVLFFLLAPRGKAFGFSGLSETAVMTPVIINFSL
Ga0245204_10497433300029686Human FecalMKQEGTGQVLFFPLALRSKALGFSVLQEHAVMIPVISIFFATLIIRYLSIHISIKK
Ga0245189_101560193300029708Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTPVIILFFEMLIIRYLSIHISIKK
Ga0245188_12148713300029722Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVINIFFAMLIIRYLSIHISIKK
Ga0245198_100378613300029727Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFLMLIIRYLSIHISIKK
Ga0245202_102028513300029749Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLSIHISI
Ga0243843_11369433300029759Human FecesVLFFPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLSIHISIKK
Ga0243804_10287133300029767Human FecesMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFVAILIIRYLSIHISIKK
Ga0168716_15176513300029770Host-AssociatedFPLALRGKAFGFSVLQKHAVMTPVISIFFEMLIIRYLYIHISIKK
Ga0244882_1000714443300029815Human FecalMKQEGTGQVLFFLLAPRGKAFGFSGLSETAVMTPVIINFSLLLIIR
Ga0245024_10205893300029819Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFAMLIIRYLSIHISIKK
Ga0245285_100262913300029848Human FecalLRGKAFGFSVLQEHAVMTPVISIFFSMLIIRYLSIHISIKK
Ga0245305_103461823300029860Human FecalMKQEGTGQVLFFLLALRGKAFGFSVLQEHAVMTPVISIFFATLIIKYLYIHISIKSNYHA
Ga0245308_12462813300029862Human FecalALRGKAFGFSVLQEHAVMTPVISIFFLMLIIRYLSIHISIKK
Ga0245314_1000272093300029871Human FecalEQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFEILIIRYLSIQISIKK
Ga0245327_10734313300029878Human FecalKAFGFSVLQEHAVMTPVISISFLVLIIRYLSIHISIKK
Ga0245307_1000270303300029881Human FecalMKQEGTGLCPVLPLALRGKAFGFSVLQEHAVMTPVISIFFATLIIRYLSIHISIKK
Ga0245330_10865153300029886Human FecalMKQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLSIH
SRS016095_WUGC_scaffold_35323__gene_905407000000069HumanMKQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLSI
C2051319__gene_2081967000000111HumanKAFGFSVLREHAVMTPVISIFFSMLIIRYLSIHISIKK
SRS050422_LANL_scaffold_24882__gene_349397000000145HumanAFGFSVLQEHAVMTPVISIFFATLIIKYLSIHLSIKK
SRS011405_WUGC_scaffold_11236__gene_221037000000213HumanALRGKAFGFSVLQKHAVMTPVISIFFEMLIIRYLYIHISIKK
SRS048164_WUGC_scaffold_24306__gene_508557000000492HumanQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK
SRS051882_Baylor_scaffold_8753__gene_196687000000570HumanGTGQVLFFTLALRGKAFGFSVLQKHAVMIPVISIFFAMLIIKHLSIHISIKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.