| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300007109 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052595 | Ga0102633 |
| Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 765620695 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 141045918 |
| Sequencing Scaffolds | 9 |
| Novel Protein Genes | 9 |
| Associated Families | 7 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp. | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F051936 | Metagenome | 143 | N |
| F062845 | Metagenome | 130 | N |
| F081354 | Metagenome | 114 | Y |
| F092227 | Metagenome | 107 | N |
| F092228 | Metagenome | 107 | N |
| F105374 | Metagenome | 100 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0102633_100402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 43564 | Open in IMG/M |
| Ga0102633_104538 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp. | 4976 | Open in IMG/M |
| Ga0102633_106407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 3525 | Open in IMG/M |
| Ga0102633_111344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2007 | Open in IMG/M |
| Ga0102633_113118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1736 | Open in IMG/M |
| Ga0102633_114502 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1575 | Open in IMG/M |
| Ga0102633_115785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 1441 | Open in IMG/M |
| Ga0102633_127955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 773 | Open in IMG/M |
| Ga0102633_139584 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0102633_100402 | Ga0102633_10040230 | F092228 | MKKKCTLVLISVLTVACIVSAYLLFFYNPSFNMVYDSDTDSYFNNSYLSYNDGTLAAADYRKTKVTAYDSKNNSTVNLPSNGCLINDNLFYINGNKLCCLYTTTNTRKIIDTDCRSFVCNNEVIAYTKNDSVILKNSDTLENIGDIKFDNQIYYINISDGNLYIAERIFEDETDEYGYSLKVGKQYIFKKYDLKSCKLLKSKNANYVNGIRYVTVCQDTFYFFCDETQTVNNVFLDKDVNYPTIQHPDVKFITSNNDCVYYISEKTESAIILKTVESPYNGIWKLEVGSNKPVKIADKCDCDELLATKNFLYCYTINYILPRGVANSWVKGYLIDQLAIS* |
| Ga0102633_104538 | Ga0102633_1045385 | F051936 | TGQVLFFPLALRGKAFGFSVLREHAVMTPVISIFFSMLIIRYLSIHISIKK* |
| Ga0102633_106407 | Ga0102633_1064071 | F026592 | CLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0102633_111344 | Ga0102633_1113442 | F081354 | VKDFSSIYPESRRRSPLKKGAVTEIPLEYGKTEVQIPFEPLQAAISSMELPKNFENKKLPNPLR* |
| Ga0102633_113118 | Ga0102633_1131184 | F026592 | PQGIAALAAQGGVATLTERSDATFSVGQFSSADRE* |
| Ga0102633_114502 | Ga0102633_1145022 | F105374 | MKKRVVLLVALCIWKVVAAQAPYGEMPERFRPDTLPCRLGGGVCFGMDGLDAAIPRGGGASSCRDPRVVFVAGDTLITFISVAGVADTALGDPVCRFYGRNVARVVSRTRRMTGGRMGAADNDFPDDPDFAELQGVVIENQKYPWESYAAGDSAYRLPVARSLVGGKEDPLLGSDMRRRYVRLLTEVSVELKAGGTRPFVHVVYLLPDP* |
| Ga0102633_115785 | Ga0102633_1157852 | F062845 | MKKTPFILHEKFRSDNNEQRKEDFQKEFERYIIDGLLNAVPSRACA* |
| Ga0102633_127955 | Ga0102633_1279552 | F092227 | MNEQKRKRILRVGCLILAGAFLLSVLGSVILMLLV* |
| Ga0102633_139584 | Ga0102633_1395842 | F026592 | PQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| ⦗Top⦘ |