NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029490

3300029490: Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001929-16



Overview

Basic Information
IMG/M Taxon OID3300029490 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133130 | Gp0283348 | Ga0244171
Sample NameHuman fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001929-16
Sequencing StatusPermanent Draft
Sequencing CenterBeijing Genomics Institute (BGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size198116432
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Ruminococcaceae bacterium LM1581
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Fecal Microbial Communities From Shanghai Jiao Tong University, China
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationChina: Shanghai
CoordinatesLat. (o)31.2123446Long. (o)121.4684853Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029444Metagenome188Y
F051936Metagenome143N
F068855Metagenome124N
F076064Metagenome118N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0244171_100023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Ruminococcaceae bacterium LM158269350Open in IMG/M
Ga0244171_100146All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides122441Open in IMG/M
Ga0244171_100262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes89086Open in IMG/M
Ga0244171_100509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales53601Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0244171_100023Ga0244171_10002397F068855VEVQGPQARKSLAPQWLQAEKESENVNVRNAGWLHSFDADYHYRGSDLHYHVNVSAALSEGGATW
Ga0244171_100146Ga0244171_10014642F051936MKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVIIIFFAMLIIRYLSIHISIKK
Ga0244171_100262Ga0244171_10026222F076064LKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHVVANDEAYYAVMKGVSLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0244171_100509Ga0244171_10050956F029444MEVSEQLTGFELEDLMSWTVSNLQRPFREDFSLEISGIIAEKESQIFGRRFVGFDGPKKAVPFFNF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.