Basic Information | |
---|---|
IMG/M Taxon OID | 3300029490 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133130 | Gp0283348 | Ga0244171 |
Sample Name | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001929-16 |
Sequencing Status | Permanent Draft |
Sequencing Center | Beijing Genomics Institute (BGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 198116432 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Ruminococcaceae bacterium LM158 | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | China: Shanghai | |||||||
Coordinates | Lat. (o) | 31.2123446 | Long. (o) | 121.4684853 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029444 | Metagenome | 188 | Y |
F051936 | Metagenome | 143 | N |
F068855 | Metagenome | 124 | N |
F076064 | Metagenome | 118 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0244171_100023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Ruminococcaceae bacterium LM158 | 269350 | Open in IMG/M |
Ga0244171_100146 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides | 122441 | Open in IMG/M |
Ga0244171_100262 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 89086 | Open in IMG/M |
Ga0244171_100509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 53601 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0244171_100023 | Ga0244171_10002397 | F068855 | VEVQGPQARKSLAPQWLQAEKESENVNVRNAGWLHSFDADYHYRGSDLHYHVNVSAALSEGGATW |
Ga0244171_100146 | Ga0244171_10014642 | F051936 | MKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVIIIFFAMLIIRYLSIHISIKK |
Ga0244171_100262 | Ga0244171_10026222 | F076064 | LKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHVVANDEAYYAVMKGVSLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY |
Ga0244171_100509 | Ga0244171_10050956 | F029444 | MEVSEQLTGFELEDLMSWTVSNLQRPFREDFSLEISGIIAEKESQIFGRRFVGFDGPKKAVPFFNF |
⦗Top⦘ |