| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029081 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127429 | Gp0193518 | Ga0169209 |
| Sample Name | Human fecal microbial communities from infant at 12 months in Denmark - 157_12M |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 57419746 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Denmark | |||||||
| Coordinates | Lat. (o) | 55.676097 | Long. (o) | 12.568337 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051936 | Metagenome | 143 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0169209_100093 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron | 137321 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0169209_100093 | Ga0169209_1000937 | F051936 | MKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVIIIFFATLIIRYLSIHISIKK |
| ⦗Top⦘ |