3300003155: Broiler Chicken cecum microbial communities from the University of Birmingham, UK

Overview

Basic Information

• IMG/M Taxon OID: 3300003155
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111493 | Gp0097869 | Ga0052270
• Sample Name: Broiler Chicken cecum microbial communities from the University of Birmingham, UK
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Birmingham
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 286286924
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium UC5.1-2G11	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Broiler Chicken Cecum Microbial Communities From The University Of Warwick, United Kingdom
• Type: Host-Associated
• Taxonomy: Host-Associated → Birds → Digestive System → Ceca → Lumen → Broiler Chicken Cecum → Broiler Chicken Cecum Microbial Communities From The University Of Warwick, United Kingdom

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut

Location Information

• Location: University of Birmingham, UK
• Coordinates
  • Lat. (^o): 50.9047
  • Long. (^o): -3.5233
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051936	Metagenome	143	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0052270_10308069	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium UC5.1-2G11	3072

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0052270_10308069	Ga0052270_103080694	F051936	MKQEGTGLCPVLPLALRGKAFGFSVLQEHAVMTLVISIFFATLIIRYLSIHISIKK*