7000000069: Human stool microbial communities from NIH, USA - visit 1, subject 764588959

Overview

Basic Information

• IMG/M Taxon OID: 7000000069
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0052541 | Ga0030498
• Sample Name: Human stool microbial communities from NIH, USA - visit 1, subject 764588959
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 168906892
• Sequencing Scaffolds: 4
• Novel Protein Genes: 4
• Associated Families: 4

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051936	Metagenome	143	N
F055775	Metagenome	138	N
F073656	Metagenome	120	N
F074899	Metagenome / Metatranscriptome	119	N

Associated Scaffolds

Scaffold	Taxonomy	Length
SRS016095_WUGC_scaffold_16098	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae	3068
SRS016095_WUGC_scaffold_33021	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes	10328
SRS016095_WUGC_scaffold_35323	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides	1136
SRS016095_WUGC_scaffold_8609	Not Available	44794

Sequences

Scaffold ID	Protein ID	Family	Sequence
SRS016095_WUGC_scaffold_16098	SRS016095_WUGC_scaffold_16098__gene_37963	F074899	DPHGEMSGRKQWNKQAVTSSFLDKKPPESLILQGLEGSTTLGKDEVGSSNLPSSSK
SRS016095_WUGC_scaffold_33021	SRS016095_WUGC_scaffold_33021__gene_83224	F073656	MTMEQDQEQMQGALYVAVDDDNKIIAMERSRRGDEGFRALLDEFTDYAANCGAIPSVLFFDIRTADAALLPRIEAAEHRYLLDPSTATEKLDIRHAVTLKDLLYCYKYDLDPLAEGNCGNMLSTKADYRQFRNEGLPPVILEDLRRCRAVETERGTVLFTQERDGREACERYMQHHADCFFDPDLGVETLRVYEVEADPDGFWDKVNPQVLPTAGGMMWVPEHPFVDAEVLRRGYCLKEYDMRATADNFWAFVDPQHGESLYVSNGIRDLTGLQIIMQRGYGYLMQNAEKYWNREFVFRSGFDNIERKYASDLSDEGRTAKREEQYNLAAYILDRKFPIRRQPSAEIPPMQAEGIRTFRNFDAINLLFRPDKLLEAYQRRRDEPVRGTEFHLKRH
SRS016095_WUGC_scaffold_35323	SRS016095_WUGC_scaffold_35323__gene_90540	F051936	MKQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLSI
SRS016095_WUGC_scaffold_8609	SRS016095_WUGC_scaffold_8609__gene_20259	F055775	MAQIAQQDNLVIEVTTTAAALDGDTKKKLIECIEGGTITDVILVTKEVEKKISHARVVSWLVDTTRDSPKYTIDIINANSGAVEAIALN