| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029819 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133133 | Gp0283647 | Ga0245024 |
| Sample Name | Human fecal microbial communities from Shanghai, China - P103V6 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 145678258 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Shanghai, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Shanghai | |||||||
| Coordinates | Lat. (o) | 31.2112312 | Long. (o) | 121.4647709 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051936 | Metagenome | 143 | N |
| F067720 | Metagenome | 125 | Y |
| F070093 | Metagenome | 123 | N |
| F087335 | Metagenome | 110 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0245024_100355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 75164 | Open in IMG/M |
| Ga0245024_100563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 51167 | Open in IMG/M |
| Ga0245024_100916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 31098 | Open in IMG/M |
| Ga0245024_102058 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 12298 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0245024_100355 | Ga0245024_10035579 | F070093 | AEFCPFRIDPPMEPEQERLFKLYSGSGIQSLPELNPNLI |
| Ga0245024_100563 | Ga0245024_10056376 | F067720 | MASTTYDDFVEVNKIAQEHFRHITKMVIGRFRDLKKTYHLGAVTVMVRNAGQLPQPFWLGAARGGGSCSLSASVARA |
| Ga0245024_100916 | Ga0245024_10091620 | F087335 | MIELYFNDANLLPENREEEQYAEAALNNILAGKTADTEMCILPCFYDAPLHKGLLYHLNDGTTLRIGPVLNEAGEPELLIRCVTEESVETVYQRAANYD |
| Ga0245024_102058 | Ga0245024_1020589 | F051936 | MKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFAMLIIRYLSIHISIKK |
| ⦗Top⦘ |