7000000570: Human stool microbial communities from NIH, USA - visit 2, subject 764143897

Overview

Basic Information

• IMG/M Taxon OID: 7000000570
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0053135 | Ga0030587
• Sample Name: Human stool microbial communities from NIH, USA - visit 2, subject 764143897
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 110221951
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides caccae	1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044554	Metagenome	154	N
F051936	Metagenome	143	N
F099451	Metagenome	103	N

Associated Scaffolds

Scaffold	Taxonomy	Length
C2561883	Not Available	1270
SRS051882_Baylor_scaffold_8753	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides caccae	5157
SRS051882_Baylor_scaffold_9868	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	56970

Sequences

Scaffold ID	Protein ID	Family	Sequence
C2561883	C2561883__gene_152609	F044554	CIFFHTQAYVLAGRFIPVLCASIARLFPCRTEIARCLTLDFAISRYLLLSFPFSFRTNFAQALFSSLLFVSDTCAKSILFLLFENEIAHLQGQYRFNSHRYCFSAFLVL
SRS051882_Baylor_scaffold_8753	SRS051882_Baylor_scaffold_8753__gene_19668	F051936	GTGQVLFFTLALRGKAFGFSVLQKHAVMIPVISIFFAMLIIKHLSIHISIKK
SRS051882_Baylor_scaffold_9868	SRS051882_Baylor_scaffold_9868__gene_22124	F099451	MEIKNVGQLRKIIENISDDYEIEMRVRRELSDEELKGCRYPYPYDTEYLTLEFDDIGVSCKVLCLGVTSKTN