Basic Information | |
---|---|
IMG/M Taxon OID | 7000000570 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053135 | Ga0030587 |
Sample Name | Human stool microbial communities from NIH, USA - visit 2, subject 764143897 |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 110221951 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides caccae | 1 |
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F044554 | Metagenome | 154 | N |
F051936 | Metagenome | 143 | N |
F099451 | Metagenome | 103 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
C2561883 | Not Available | 1270 | Open in IMG/M |
SRS051882_Baylor_scaffold_8753 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides caccae | 5157 | Open in IMG/M |
SRS051882_Baylor_scaffold_9868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 56970 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
C2561883 | C2561883__gene_152609 | F044554 | CIFFHTQAYVLAGRFIPVLCASIARLFPCRTEIARCLTLDFAISRYLLLSFPFSFRTNFAQALFSSLLFVSDTCAKSILFLLFENEIAHLQGQYRFNSHRYCFSAFLVL |
SRS051882_Baylor_scaffold_8753 | SRS051882_Baylor_scaffold_8753__gene_19668 | F051936 | GTGQVLFFTLALRGKAFGFSVLQKHAVMIPVISIFFAMLIIKHLSIHISIKK |
SRS051882_Baylor_scaffold_9868 | SRS051882_Baylor_scaffold_9868__gene_22124 | F099451 | MEIKNVGQLRKIIENISDDYEIEMRVRRELSDEELKGCRYPYPYDTEYLTLEFDDIGVSCKVLCLGVTSKTN |
⦗Top⦘ |