| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300023717 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133482 | Gp0296381 | Ga0257029 |
| Sample Name | Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_128B |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of California, Irvine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 89158579 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Child Gut Microbiome |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Northridge, California | |||||||
| Coordinates | Lat. (o) | 34.2381 | Long. (o) | -118.5301 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051936 | Metagenome | 143 | N |
| F062845 | Metagenome | 130 | N |
| F078693 | Metagenome | 116 | N |
| F097493 | Metagenome | 104 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0257029_10087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 131351 | Open in IMG/M |
| Ga0257029_10140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 100106 | Open in IMG/M |
| Ga0257029_10368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 44395 | Open in IMG/M |
| Ga0257029_12265 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 6521 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0257029_10087 | Ga0257029_1008730 | F062845 | MKKTPFILHEKFRSDNNEQRKERFQKEFERYIIDGLLNAIPPSSCA |
| Ga0257029_10140 | Ga0257029_1014071 | F097493 | MYKFHMKNGTAYFYEHGVEIDGTVYGIHTDRDILRIKRRIVNDKFAETDDNFDMDTEIAKIQHTDITFEQPTSEQLSQIQSKTFDSMSDMKQYVQSVMNGELTQDEINAMLLLKIAEMEVAITNEQTTN |
| Ga0257029_10368 | Ga0257029_1036845 | F078693 | MVLALVRGAERFYVKWNCSLLMSKENQKTTSDFDALDPRERGCSPLSDPKGVVETEKS |
| Ga0257029_12265 | Ga0257029_122651 | F051936 | TGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRNLSIHISIKK |
| ⦗Top⦘ |