Basic Information | |
---|---|
IMG/M Taxon OID | 3300029476 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133130 | Gp0283323 | Ga0244146 |
Sample Name | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001904-94 |
Sequencing Status | Permanent Draft |
Sequencing Center | Beijing Genomics Institute (BGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 158475688 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1 |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | China: Shanghai | |||||||
Coordinates | Lat. (o) | 31.2123446 | Long. (o) | 121.4684853 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047125 | Metagenome / Metatranscriptome | 150 | N |
F051936 | Metagenome | 143 | N |
F070093 | Metagenome | 123 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0244146_100527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 52326 | Open in IMG/M |
Ga0244146_101253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 20043 | Open in IMG/M |
Ga0244146_102216 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 9744 | Open in IMG/M |
Ga0244146_113252 | Not Available | 1433 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0244146_100527 | Ga0244146_10052714 | F047125 | MDVVLLLMVLGVMLSGFWAADALDYMRKEIIRQEGKRRGWWS |
Ga0244146_101253 | Ga0244146_1012531 | F070093 | SNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPN |
Ga0244146_102216 | Ga0244146_1022161 | F051936 | GQVLFFPLALRGKAFGFSVLQEHAVITPVISISHSRFIIRHLSIHISIKK |
Ga0244146_113252 | Ga0244146_1132521 | F070093 | CRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNTI |
⦗Top⦘ |