Basic Information | |
---|---|
IMG/M Taxon OID | 3300014754 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151550 | Ga0134378 |
Sample Name | Human fecal microbial communities from obese patients in Germany - AS50_0 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Hohenheim |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 84753789 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. 20_3 | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Obese Patients In Germany |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Germany | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032286 | Metagenome / Metatranscriptome | 180 | Y |
F044554 | Metagenome | 154 | N |
F051936 | Metagenome | 143 | N |
F078822 | Metagenome | 116 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0134378_100578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 19501 | Open in IMG/M |
Ga0134378_100605 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. 20_3 | 18302 | Open in IMG/M |
Ga0134378_100800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | 12356 | Open in IMG/M |
Ga0134378_104442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1951 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0134378_100578 | Ga0134378_1005782 | F078822 | LSSTFFDIFLSFPNAFLKAFHPHAIRFPAAFLLVHRFYLAFEELLSCATAYL* |
Ga0134378_100605 | Ga0134378_10060523 | F051936 | MKQEGTGQVLFFPLALRGKAFGFSGLSETAVMTPVIINFSLLLIIR* |
Ga0134378_100800 | Ga0134378_1008002 | F044554 | VLAGRFIPVLCASIARLFPCRTEIARCLTLDFAISRYLFLSFSFSFRANFAQALFSSLLFVSDTRAKSILFLLFENEIAHLQGQYRFNSHRYCFSAFLVL* |
Ga0134378_104442 | Ga0134378_1044422 | F032286 | MVKWVCQIVIPVRRRALVFDVRFFAGNAADDTLVTGGTFRFCRLMCLCVKRRNVILNGKRRSLPDSALFHADNRTEQKTISPFSLALIFTFDFAALSERRSCPEDRSRRFVLLGALDAALRQRTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKNADFHAYGQDRKRTEN* |
⦗Top⦘ |