| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014935 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127429 | Gp0193812 | Ga0169825 |
| Sample Name | Human fecal microbial communities from infant at 12 months in Denmark - 598_12M |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 91346478 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Denmark | |||||||
| Coordinates | Lat. (o) | 55.678 | Long. (o) | 12.531 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051936 | Metagenome | 143 | N |
| F052660 | Metagenome | 142 | N |
| F062845 | Metagenome | 130 | N |
| F070093 | Metagenome | 123 | N |
| F078693 | Metagenome | 116 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0169825_100075 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides | 138638 | Open in IMG/M |
| Ga0169825_100723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 16911 | Open in IMG/M |
| Ga0169825_101957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 5242 | Open in IMG/M |
| Ga0169825_113651 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| Ga0169825_119198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 642 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0169825_100075 | Ga0169825_10007522 | F051936 | MKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMAPVISIFSAMLIIKHLSIHISIKK* |
| Ga0169825_100723 | Ga0169825_1007239 | F052660 | MCILRVLPEKTSERIGQERAGTEWTVVKSKIRLCIRNRSYGRFLHGGILMGIALPIPAHRAKSHDFACWWPAAADHSRSADALPGKSNF* |
| Ga0169825_101957 | Ga0169825_1019574 | F062845 | MKKTPFILHEKFRSDNNEQRKEWFQKEFERYIIDGLLNAVPSSSCA* |
| Ga0169825_113651 | Ga0169825_1136512 | F070093 | PFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPKSI* |
| Ga0169825_119198 | Ga0169825_1191982 | F078693 | MVVAPVRGAERFFIKADCSLLMSKENQKTTSDFDALDPRERGCSPLSDPKGVVETEKS* |
| ⦗Top⦘ |