| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029513 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133130 | Gp0283433 | Ga0244810 |
| Sample Name | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005377-43 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 147285683 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Shanghai | |||||||
| Coordinates | Lat. (o) | 31.2123446 | Long. (o) | 121.4684853 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051936 | Metagenome | 143 | N |
| F076064 | Metagenome | 118 | N |
| F081354 | Metagenome | 114 | Y |
| F081453 | Metagenome | 114 | N |
| F089005 | Metagenome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0244810_100301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 62800 | Open in IMG/M |
| Ga0244810_101177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 17791 | Open in IMG/M |
| Ga0244810_102156 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 9988 | Open in IMG/M |
| Ga0244810_106586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia | 3205 | Open in IMG/M |
| Ga0244810_129464 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 653 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0244810_100301 | Ga0244810_1003015 | F081354 | LVRENQQSSAHNFVKDFSLIFLKFSRRSPLKKGAATENPLEYGKTEVQILFEPLQAAISSMELPKNFENKKLPNPLR |
| Ga0244810_101177 | Ga0244810_10117720 | F089005 | LTKSKQRSIIVLALLRLATSNEESKQALKVRRTLKIEQRENSKETRNDFEESSKNYSEMYTKKHH |
| Ga0244810_102156 | Ga0244810_1021561 | F051936 | EQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVIRISFSILIIRHL |
| Ga0244810_106586 | Ga0244810_1065866 | F081453 | LPKEMSPFFLWIGENIVEKYISANPVCGTNIQPPEPAVKGAPGRKCIQ |
| Ga0244810_129464 | Ga0244810_1294641 | F076064 | ALENLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPKPALKFY |
| ⦗Top⦘ |