Basic Information | |
---|---|
IMG/M Taxon OID | 3300006487 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052518 | Ga0100256 |
Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 159591683 |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 35753258 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp. 3_2_5 | 1 |
All Organisms → cellular organisms → Bacteria | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051936 | Metagenome | 143 | N |
F055775 | Metagenome | 138 | N |
F076064 | Metagenome | 118 | N |
F097493 | Metagenome | 104 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0100256_10689 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 11237 | Open in IMG/M |
Ga0100256_10979 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp. 3_2_5 | 6581 | Open in IMG/M |
Ga0100256_13311 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
Ga0100256_14004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 527 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0100256_10689 | Ga0100256_1068913 | F076064 | LKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGISLFTSEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPTPALKFY* |
Ga0100256_10979 | Ga0100256_109791 | F051936 | LRGKAFGFSVLQEHAVMTPVISIFFAVLIIRYLSIHISIKK* |
Ga0100256_13311 | Ga0100256_133112 | F055775 | MAQIAQQDNLVIEVTKTAAALDGDTKKKLIECIEGGTITDVILVTKEVEKKISHARVVSWLVDTTGDSPKYTIDIINANSKTVEAIALN* |
Ga0100256_14004 | Ga0100256_140042 | F097493 | SKNGTAQSYERGVKIDGTVYGIQKDSDILRIKRGIVNDKFAETDDNFDMDTEIAKIQHTSITFKQPTSEQLSQIQAKTYNSMTELKQHVQSVMNGDEMSQDEINAMLMLQIAELKAGVDGE* |
⦗Top⦘ |