NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000492

7000000492: Human stool microbial communities from NIH, USA - visit 1, subject 861967750



Overview

Basic Information
IMG/M Taxon OID7000000492 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053044 | Ga0030538
Sample NameHuman stool microbial communities from NIH, USA - visit 1, subject 861967750
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size139600878
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051936Metagenome143N
F073656Metagenome120N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
SRS048164_WUGC_scaffold_24306All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides659Open in IMG/M
SRS048164_WUGC_scaffold_41201All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1846Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
SRS048164_WUGC_scaffold_24306SRS048164_WUGC_scaffold_24306__gene_50855F051936QEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK
SRS048164_WUGC_scaffold_41201SRS048164_WUGC_scaffold_41201__gene_96202F073656AALLPRIEAAEHRYLLDPSTATEKLDIRHAVTLKDLLYCYKYDLDPLAEGNCGNMLSTKADYRQFRNEGLPPVILEDLRRCRAVETERGTVLFTQERDGREACERYMQHHADCFFDPDLGVETLRVYEVEADPDGFWDKVNPQVLPTAGGMMWVPEHPFVDAEVLRRGYCLKEYDMRATADNFWAFVDPQHGESLYVSNGIRDLTGLQIIMQRGYGYLMQNAEKYWNREFVFRSGFDNIERKYASDLSDEGRTAKREEQYNLAAYILDRKFPIRRQPSAEIPPMQAEGIRTFRNFDAINLLFRPDKLLEAYQRRRDEPVRGTEFHLKRH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.