3300029665: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 038_10_27_stool_2

Overview

Basic Information

• IMG/M Taxon OID: 3300029665
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133117 | Gp0282926 | Ga0243765
• Sample Name: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 038_10_27_stool_2
• Sequencing Status: Permanent Draft
• Sequencing Center: Institute for Genome Sciences, University of Maryland School of Medicine
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 118885674
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: USA: Baltimore
• Coordinates
  • Lat. (^o): 39.28846264
  • Long. (^o): -76.62594594
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051936	Metagenome	143	N
F056309	Metagenome	137	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0243765_100030	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis	205713
Ga0243765_102844	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena	5547
Ga0243765_112356	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1195

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0243765_100030	Ga0243765_10003074	F051936	MKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISISFSMLIVRYLSIHISIKK
Ga0243765_102844	Ga0243765_1028441	F056309	GTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSLVSFKD
Ga0243765_112356	Ga0243765_1123563	F056309	SLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFMD