3300028965: Human fecal microbial communities from infant at 4 months in Denmark - 39_4M

Overview

Basic Information

• IMG/M Taxon OID: 3300028965
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0127429 | Gp0193689 | Ga0169695
• Sample Name: Human fecal microbial communities from infant at 4 months in Denmark - 39_4M
• Sequencing Status: Permanent Draft
• Sequencing Center: Beijing Genomics Institute (BGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 55689057
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → Parabacteroides goldsteinii	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → Parabacteroides merdae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Denmark
• Coordinates
  • Lat. (^o): 55.678
  • Long. (^o): 12.531
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051936	Metagenome	143	N
F099451	Metagenome	103	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0169695_100102	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → Parabacteroides goldsteinii	86481
Ga0169695_100567	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → Parabacteroides merdae	16666

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0169695_100102	Ga0169695_10010215	F051936	MKQEGTGQVLFFPLALRGKAFGFSVLQKHAAMTPVISIAKKMLIIRYLSIHISIKK
Ga0169695_100567	Ga0169695_10056727	F099451	MRIDKIKTVGQLRKVIENLSDDYEIEMRIRRKLTDEDIIKLHKKYGKIYPYPYETSYSELEFDDVGVSDKVLCLGVELKE