Basic Information | |
---|---|
IMG/M Taxon OID | 3300029886 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133139 | Gp0283964 | Ga0245330 |
Sample Name | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35724 |
Sequencing Status | Permanent Draft |
Sequencing Center | Beijing Genomics Institute (BGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 114113992 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Unclassified |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | United Kingdom: London | |||||||
Coordinates | Lat. (o) | 51.5 | Long. (o) | -0.12 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051936 | Metagenome | 143 | N |
F059106 | Metagenome | 134 | N |
F089005 | Metagenome | 109 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0245330_101032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 16791 | Open in IMG/M |
Ga0245330_108651 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 1730 | Open in IMG/M |
Ga0245330_111342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1187 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0245330_101032 | Ga0245330_10103223 | F089005 | LTKSKQSSIIALALLRCATSNEESKQALKVRRTLKIEQRDNSKETRNDFEESSKNYSEMYTKKHQE |
Ga0245330_108651 | Ga0245330_1086515 | F051936 | MKQEGTGQVLFFPLALRGKAFGFSVLQKHAVMTSVISIFFATLIIRYLSIH |
Ga0245330_111342 | Ga0245330_1113422 | F059106 | LQIFAWTVDLKVRGHLTGYLRKDIKYRRVTIGVHV |
⦗Top⦘ |