| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014767 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121299 | Gp0151678 | Ga0134506 |
| Sample Name | Human fecal microbial communities from ulcerative colitis therapy, University of Washington - UWIBD01P788T1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Washington |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 90480455 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Commmunities From Fecal Microbiota Transplantation (Fmt) For Ulcerative Colitis - University Of Washington |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Commmunities From Fecal Microbiota Transplantation (Fmt) For Ulcerative Colitis - University Of Washington |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: University of Washington | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051936 | Metagenome | 143 | N |
| F062845 | Metagenome | 130 | N |
| F068811 | Metagenome | 124 | N |
| F076189 | Metagenome | 118 | N |
| F076190 | Metagenome | 118 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134506_100452 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 16736 | Open in IMG/M |
| Ga0134506_106702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 2077 | Open in IMG/M |
| Ga0134506_123502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 739 | Open in IMG/M |
| Ga0134506_125189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 697 | Open in IMG/M |
| Ga0134506_127693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 642 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134506_100452 | Ga0134506_10045218 | F051936 | VLFFPLALRGKAFGFSVLQEHAVMTPVISIFFSVLIITYLSIHISIKK* |
| Ga0134506_106702 | Ga0134506_1067022 | F062845 | MKKTPFILHEKFRSDNNEQRKEDFQKEFERYIIDGLLNAVPSRVCT* |
| Ga0134506_123502 | Ga0134506_1235022 | F076189 | MPGRLCYLPGIAFFLSPFIKPLLYVEKLQIGTVLPVVSDLYREFAELAAYFDLYAIQSAQKQLRMLCNFHENTFGLLIFYANYAIL* |
| Ga0134506_125189 | Ga0134506_1251892 | F068811 | MDQDGSEHNICSNREGLRPGKKQHGASGWKQIFQHGKEPLRNKDSVSQYCNKKVAVSLILNENVSETLCIFSIDKTNGCRI* |
| Ga0134506_127693 | Ga0134506_1276931 | F076190 | FTAASRVSGRVWSLVRITVPNGLKSVRIWVEKTQNNSLYPYFQREPL* |
| ⦗Top⦘ |