| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008455 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053280 | Ga0115313 |
| Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 686765762 reassembly |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 64551292 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 5 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. D26 | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → unclassified Roseburia → Roseburia sp. | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | National Institutes of Health, USA | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051936 | Metagenome | 143 | N |
| F062845 | Metagenome | 130 | N |
| F097172 | Metagenome / Metatranscriptome | 104 | Y |
| F101356 | Metagenome | 102 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0115313_101701 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. D26 | 5979 | Open in IMG/M |
| Ga0115313_101863 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis | 5489 | Open in IMG/M |
| Ga0115313_109531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → unclassified Roseburia → Roseburia sp. | 1195 | Open in IMG/M |
| Ga0115313_114424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 800 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0115313_101701 | Ga0115313_1017017 | F051936 | ETGQVLFSPLALRGKAFGFSVLQEHAVMTPIISIFFVMLIIRYLSIHISIKK* |
| Ga0115313_101863 | Ga0115313_1018631 | F051936 | EQVLFFPLALRGKAFGFSVLQKHAVMTPVISIFFEMLIIRYLYIHISIKK* |
| Ga0115313_109531 | Ga0115313_1095311 | F097172 | MLKKLMCAVLTAVCVATAVVPAMADDVITAEAATKKVTSAYKYHLEGYDKNGYPVSGFSKTSFYKDLNSLPAVKTGKTTINVPAITSSVKSISKEKGNPRYKSFVKFKAPKTGKYVFTIDNLQGTDDKSLKCMADGDLCQISKTCKKYGLDGVEDSDTVGKYDTLYENNYLARLRTILDNYKAEHPEYADVIEETYEYKTDFVNKYPVNKIKFTTKLKKGQTYVFVIDNIGMQKAVPPYFTTHGSNEQSCLWGGNYLAAYSFDMNIEYKK* |
| Ga0115313_114424 | Ga0115313_1144241 | F062845 | MKKTPFILHEKFRSDNNEQRKEHFQKKFERYIVDELSNTAPSKSCA* |
| Ga0115313_119943 | Ga0115313_1199432 | F101356 | EKDGLSNSKFATTKIKSEGKRSVLLYRSSSSQWAPFAIRVSCISTGEPLSDFCVYIAGNTMELQDSTKVYVKYLYGQPNSDTYLKMKYETDHRISIYLTSDNSLGDRTIVRELIVRDSMYDMATQDDEITGLADCTIMQ* |
| ⦗Top⦘ |