NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008455

3300008455: Human stool microbial communities from NIH, USA - visit 1, subject 686765762 reassembly



Overview

Basic Information
IMG/M Taxon OID3300008455 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053280 | Ga0115313
Sample NameHuman stool microbial communities from NIH, USA - visit 1, subject 686765762 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size64551292
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. D261
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → unclassified Roseburia → Roseburia sp.1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationNational Institutes of Health, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051936Metagenome143N
F062845Metagenome130N
F097172Metagenome / Metatranscriptome104Y
F101356Metagenome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0115313_101701All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. D265979Open in IMG/M
Ga0115313_101863All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis5489Open in IMG/M
Ga0115313_109531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → unclassified Roseburia → Roseburia sp.1195Open in IMG/M
Ga0115313_114424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales800Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0115313_101701Ga0115313_1017017F051936ETGQVLFSPLALRGKAFGFSVLQEHAVMTPIISIFFVMLIIRYLSIHISIKK*
Ga0115313_101863Ga0115313_1018631F051936EQVLFFPLALRGKAFGFSVLQKHAVMTPVISIFFEMLIIRYLYIHISIKK*
Ga0115313_109531Ga0115313_1095311F097172MLKKLMCAVLTAVCVATAVVPAMADDVITAEAATKKVTSAYKYHLEGYDKNGYPVSGFSKTSFYKDLNSLPAVKTGKTTINVPAITSSVKSISKEKGNPRYKSFVKFKAPKTGKYVFTIDNLQGTDDKSLKCMADGDLCQISKTCKKYGLDGVEDSDTVGKYDTLYENNYLARLRTILDNYKAEHPEYADVIEETYEYKTDFVNKYPVNKIKFTTKLKKGQTYVFVIDNIGMQKAVPPYFTTHGSNEQSCLWGGNYLAAYSFDMNIEYKK*
Ga0115313_114424Ga0115313_1144241F062845MKKTPFILHEKFRSDNNEQRKEHFQKKFERYIVDELSNTAPSKSCA*
Ga0115313_119943Ga0115313_1199432F101356EKDGLSNSKFATTKIKSEGKRSVLLYRSSSSQWAPFAIRVSCISTGEPLSDFCVYIAGNTMELQDSTKVYVKYLYGQPNSDTYLKMKYETDHRISIYLTSDNSLGDRTIVRELIVRDSMYDMATQDDEITGLADCTIMQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.