NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F084342

Metagenome Family F084342

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084342
Family Type Metagenome
Number of Sequences 112
Average Sequence Length 64 residues
Representative Sequence VSGQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
Number of Associated Samples 112
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.46 %
% of genes near scaffold ends (potentially truncated) 35.71 %
% of genes from short scaffolds (< 2000 bps) 60.71 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.857 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human
(38.393 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
(94.643 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 60.29%    β-sheet: 0.00%    Coil/Unstructured: 39.71%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF04055Radical_SAM 19.64
PF01938TRAM 5.36
PF02899Phage_int_SAM_1 5.36
PF02887PK_C 5.36
PF11028DUF2723 5.36
PF00589Phage_integrase 1.79
PF00664ABC_membrane 0.89
PF02844GARS_N 0.89
PF02861Clp_N 0.89
PF00224PK 0.89
PF03577Peptidase_C69 0.89
PF00453Ribosomal_L20 0.89
PF02910Succ_DH_flav_C 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 6.25
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 5.36
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 5.36
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 0.89
COG0292Ribosomal protein L20Translation, ribosomal structure and biogenesis [J] 0.89
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 0.89
COG4690DipeptidaseAmino acid transport and metabolism [E] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.86 %
UnclassifiedrootN/A7.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006319|Ga0099581_137624All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae702Open in IMG/M
3300006898|Ga0102522_116269All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae639Open in IMG/M
3300007122|Ga0102683_125887All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas650Open in IMG/M
3300007208|Ga0103291_127838All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas679Open in IMG/M
3300007268|Ga0104869_109555All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas686Open in IMG/M
3300007295|Ga0104867_1001300All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27913193Open in IMG/M
3300007297|Ga0104793_112225All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1792Open in IMG/M
3300007300|Ga0104843_101721All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27911309Open in IMG/M
3300007316|Ga0104922_100048All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27999281Open in IMG/M
3300007318|Ga0104925_100412All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27915746Open in IMG/M
3300007339|Ga0104971_100292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27924439Open in IMG/M
3300007355|Ga0104762_1000071All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27956172Open in IMG/M
3300007367|Ga0104973_100309All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27915278Open in IMG/M
3300007368|Ga0104977_1005953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2795362Open in IMG/M
3300007566|Ga0104970_1019105Not Available1786Open in IMG/M
3300007638|Ga0105526_1000192All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27961162Open in IMG/M
3300007660|Ga0105538_100129All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27913799Open in IMG/M
3300007662|Ga0105539_101821All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2794567Open in IMG/M
3300007663|Ga0105541_1008464All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp.1929Open in IMG/M
3300007736|Ga0105757_1017623Not Available1644Open in IMG/M
3300007746|Ga0105776_1000396All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27922155Open in IMG/M
3300007803|Ga0105780_102984All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2796564Open in IMG/M
3300007828|Ga0105961_115299All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae624Open in IMG/M
3300007938|Ga0114251_112762All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas684Open in IMG/M
3300007968|Ga0105969_109410All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1615Open in IMG/M
3300008061|Ga0111056_101224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2793557Open in IMG/M
3300008074|Ga0114852_122042All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae670Open in IMG/M
3300008080|Ga0105957_136899All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas687Open in IMG/M
3300008090|Ga0114309_101275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27912260Open in IMG/M
3300008123|Ga0114854_100895All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27916210Open in IMG/M
3300008126|Ga0114844_1016561All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1761Open in IMG/M
3300008127|Ga0114846_119647All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae559Open in IMG/M
3300008128|Ga0114847_108937All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1861Open in IMG/M
3300008133|Ga0111365_126936All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae974Open in IMG/M
3300008136|Ga0113979_112713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp.2803Open in IMG/M
3300008142|Ga0114286_1010846All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas4329Open in IMG/M
3300008144|Ga0114284_1006791All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2794260Open in IMG/M
3300008155|Ga0114001_108538All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2793246Open in IMG/M
3300008269|Ga0114154_104949All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2794613Open in IMG/M
3300008271|Ga0111085_100018All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279202344Open in IMG/M
3300008278|Ga0114262_128559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae848Open in IMG/M
3300008279|Ga0114263_1000290All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27926534Open in IMG/M
3300008302|Ga0114874_105219All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300008331|Ga0114894_105945Not Available1778Open in IMG/M
3300008364|Ga0114890_117873All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1026Open in IMG/M
3300008406|Ga0115224_1001925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27911789Open in IMG/M
3300008420|Ga0115228_142046All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas653Open in IMG/M
3300008436|Ga0115418_105396All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp.2629Open in IMG/M
3300008474|Ga0115375_100842All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2797221Open in IMG/M
3300008489|Ga0111007_101468All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2798368Open in IMG/M
3300008493|Ga0111009_1013014Not Available2411Open in IMG/M
3300008506|Ga0115176_1021304All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1809Open in IMG/M
3300008521|Ga0115192_102397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2795879Open in IMG/M
3300008534|Ga0111050_108303All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1736Open in IMG/M
3300008537|Ga0111051_100293All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27950529Open in IMG/M
3300008565|Ga0111061_1002211All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2797677Open in IMG/M
3300008688|Ga0111559_1000085All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27948881Open in IMG/M
3300008695|Ga0113557_124263All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1100Open in IMG/M
3300008715|Ga0115609_1053935All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae512Open in IMG/M
3300008717|Ga0113876_137781All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae661Open in IMG/M
3300008734|Ga0113998_100683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27933056Open in IMG/M
3300008749|Ga0115681_112628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae842Open in IMG/M
3300009963|Ga0133749_14117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae607Open in IMG/M
3300009964|Ga0133739_13604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae619Open in IMG/M
3300011980|Ga0119777_1068547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae507Open in IMG/M
3300014037|Ga0119816_1052363All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas814Open in IMG/M
3300014038|Ga0119819_1023420All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1693Open in IMG/M
3300014090|Ga0134343_107085All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae602Open in IMG/M
7000000001|SRS022530_LANL_scaffold_59194All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae623Open in IMG/M
7000000005|C4541841All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae502Open in IMG/M
7000000018|SRS022725_LANL_scaffold_97308All Organisms → cellular organisms → Bacteria2600Open in IMG/M
7000000028|SRS024138_Baylor_scaffold_9390All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1731Open in IMG/M
7000000029|SRS042131_WUGC_scaffold_55213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae985Open in IMG/M
7000000052|C3041294All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas596Open in IMG/M
7000000062|C2235392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae669Open in IMG/M
7000000104|SRS019225_WUGC_scaffold_33832All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae572Open in IMG/M
7000000118|SRS024289_LANL_scaffold_68997Not Available1674Open in IMG/M
7000000126|C1781156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas658Open in IMG/M
7000000132|SRS012285_Baylor_scaffold_18783All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas gingivalis7470Open in IMG/M
7000000140|SRS044373_WUGC_scaffold_34546All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae676Open in IMG/M
7000000147|C1860308All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae639Open in IMG/M
7000000182|C2062548All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas661Open in IMG/M
7000000194|SRS022077_Baylor_scaffold_46639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae538Open in IMG/M
7000000197|SRS017808_Baylor_scaffold_12041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae505Open in IMG/M
7000000205|SRS011247_Baylor_scaffold_24036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1588Open in IMG/M
7000000221|C1247766All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae520Open in IMG/M
7000000228|SRS022602_Baylor_scaffold_42961All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1498Open in IMG/M
7000000244|SRS016575_Baylor_scaffold_66762All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas gingivalis4737Open in IMG/M
7000000286|SRS024081_LANL_scaffold_7750All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae926Open in IMG/M
7000000298|SRS016569_Baylor_scaffold_18745All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1020Open in IMG/M
7000000313|SRS058053_LANL_scaffold_83394All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales3524Open in IMG/M
7000000316|SRS017511_Baylor_scaffold_79708All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1323Open in IMG/M
7000000369|C2089852Not Available1361Open in IMG/M
7000000371|SRS047113_LANL_scaffold_57537All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1525Open in IMG/M
7000000392|SRS023557_Baylor_scaffold_27158All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2245Open in IMG/M
7000000393|SRS019327_WUGC_scaffold_39896All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1684Open in IMG/M
7000000398|SRS024470_LANL_scaffold_5696All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae549Open in IMG/M
7000000404|C4306431All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae588Open in IMG/M
7000000411|SRS042984_LANL_scaffold_13487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales20120Open in IMG/M
7000000440|SRS015797_WUGC_scaffold_34400All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae515Open in IMG/M
7000000457|SRS024447_LANL_scaffold_26951All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1473Open in IMG/M
7000000472|SRS051244_LANL_scaffold_46583All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas gingivalis4687Open in IMG/M
7000000494|C2618103All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae627Open in IMG/M
7000000574|SRS017691_Baylor_scaffold_77734All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas gingivalis8631Open in IMG/M
7000000583|SRS019974_Baylor_scaffold_57175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2460Open in IMG/M
7000000605|SRS019028_WUGC_scaffold_51759Not Available2228Open in IMG/M
7000000606|C3251163All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae647Open in IMG/M
7000000618|SRS062544_LANL_scaffold_51124Not Available1613Open in IMG/M
7000000631|SRS050029_WUGC_scaffold_189All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae646Open in IMG/M
7000000653|SRS016740_Baylor_scaffold_61493All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1538Open in IMG/M
7000000676|SRS018665_WUGC_scaffold_23797All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2028Open in IMG/M
7000000700|SRS011310_Baylor_scaffold_15757All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1632Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
HumanHost-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human38.39%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human35.71%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human16.96%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral2.68%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human1.79%
Human Oral CavityHost-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral Cavity1.79%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral0.89%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human0.89%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Attached/Keratinized Gingiva → Human0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006319Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764062976Host-AssociatedOpen in IMG/M
3300006898Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160400887Host-AssociatedOpen in IMG/M
3300007122Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763982056Host-AssociatedOpen in IMG/M
3300007208Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763901136 replicate 1Host-AssociatedOpen in IMG/M
3300007268Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 763840445 reassemblyHost-AssociatedOpen in IMG/M
3300007295Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159814214 reassemblyHost-AssociatedOpen in IMG/M
3300007297Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158337416 reassemblyHost-AssociatedOpen in IMG/M
3300007300Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160603188 reassemblyHost-AssociatedOpen in IMG/M
3300007316Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159571453 reassemblyHost-AssociatedOpen in IMG/M
3300007318Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 158742018 reassemblyHost-AssociatedOpen in IMG/M
3300007339Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763820215 reassemblyHost-AssociatedOpen in IMG/M
3300007355Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765640925 reassemblyHost-AssociatedOpen in IMG/M
3300007367Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 763820215 reassemblyHost-AssociatedOpen in IMG/M
3300007368Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158499257 reassemblyHost-AssociatedOpen in IMG/M
3300007566Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763840445 reassemblyHost-AssociatedOpen in IMG/M
3300007638Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159915365 reassemblyHost-AssociatedOpen in IMG/M
3300007660Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159915365 reassemblyHost-AssociatedOpen in IMG/M
3300007662Human throat microbial communities from NIH, USA - visit 2, subject 765560005 reassemblyHost-AssociatedOpen in IMG/M
3300007663Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765701615 reassemblyHost-AssociatedOpen in IMG/M
3300007736Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 604812005 reassemblyHost-AssociatedOpen in IMG/M
3300007746Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160502038 reassemblyHost-AssociatedOpen in IMG/M
3300007803Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763435843 reassemblyHost-AssociatedOpen in IMG/M
3300007828Human attached/keratinized gingiva microbial communities from NIH, USA - visit 2, subject 763961826 reassemblyHost-AssociatedOpen in IMG/M
3300007938Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 158479027 reassemblyHost-AssociatedOpen in IMG/M
3300007968Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764447348 reassemblyHost-AssociatedOpen in IMG/M
3300008061Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159571453 reassemblyHost-AssociatedOpen in IMG/M
3300008074Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764143897 reassemblyHost-AssociatedOpen in IMG/M
3300008080Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763759525 reassemblyHost-AssociatedOpen in IMG/M
3300008090Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160643649 reassemblyHost-AssociatedOpen in IMG/M
3300008123Human supragingival plaque microbial communities from NIH, USA - visit number 3 of subject 159510762 reassemblyHost-AssociatedOpen in IMG/M
3300008126Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763961826 reassemblyHost-AssociatedOpen in IMG/M
3300008127Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765337473 reassemblyHost-AssociatedOpen in IMG/M
3300008128Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159713063 reassemblyHost-AssociatedOpen in IMG/M
3300008133Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763840445 reassemblyHost-AssociatedOpen in IMG/M
3300008136Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764811490 reassemblyHost-AssociatedOpen in IMG/M
3300008142Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159814214 reassemblyHost-AssociatedOpen in IMG/M
3300008144Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764143897 reassemblyHost-AssociatedOpen in IMG/M
3300008155Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 370425937 reassemblyHost-AssociatedOpen in IMG/M
3300008269Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300008271Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 638754422 reassemblyHost-AssociatedOpen in IMG/M
3300008278Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764649650 reassemblyHost-AssociatedOpen in IMG/M
3300008279Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 338793263 reassemblyHost-AssociatedOpen in IMG/M
3300008302Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 338793263 reassemblyHost-AssociatedOpen in IMG/M
3300008331Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764224817 reassemblyHost-AssociatedOpen in IMG/M
3300008364Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763577454 reassemblyHost-AssociatedOpen in IMG/M
3300008406Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765701615 reassemblyHost-AssociatedOpen in IMG/M
3300008420Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160218816 reassemblyHost-AssociatedOpen in IMG/M
3300008436Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 370425937 reassemblyHost-AssociatedOpen in IMG/M
3300008474Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 158944319 reassemblyHost-AssociatedOpen in IMG/M
3300008489Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764811490 reassemblyHost-AssociatedOpen in IMG/M
3300008493Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763901136 replicate 2 reassemblyHost-AssociatedOpen in IMG/M
3300008506Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 159510762 reassemblyHost-AssociatedOpen in IMG/M
3300008521Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 370425937 reassemblyHost-AssociatedOpen in IMG/M
3300008534Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158802708 reassemblyHost-AssociatedOpen in IMG/M
3300008537Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765337473 reassemblyHost-AssociatedOpen in IMG/M
3300008565Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158499257 reassemblyHost-AssociatedOpen in IMG/M
3300008688Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 861967750 reassemblyHost-AssociatedOpen in IMG/M
3300008695Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764083206 replicate 1 reassemblyHost-AssociatedOpen in IMG/M
3300008715Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763577454 reassemblyHost-AssociatedOpen in IMG/M
3300008717Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158479027 reassemblyHost-AssociatedOpen in IMG/M
3300008734Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765013792 reassemblyHost-AssociatedOpen in IMG/M
3300008749Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 763759525 reassemblyHost-AssociatedOpen in IMG/M
3300009963Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 9Host-AssociatedOpen in IMG/M
3300009964Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 5Host-AssociatedOpen in IMG/M
3300011980Human oral microbial communities from Los Angeles, CA, USA - S01-01-DHost-AssociatedOpen in IMG/M
3300014037Human oral microbial communities from Los Angeles, CA, USA - S21-04-RHost-AssociatedOpen in IMG/M
3300014038Human oral microbial communities from Los Angeles, CA, USA - S27-04-RHost-AssociatedOpen in IMG/M
3300014090Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_099Host-AssociatedOpen in IMG/M
7000000001Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 809635352Host-AssociatedOpen in IMG/M
7000000005Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 809635352Host-AssociatedOpen in IMG/M
7000000018Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 370425937Host-AssociatedOpen in IMG/M
7000000028Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 159207311Host-AssociatedOpen in IMG/M
7000000029Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 764487809Host-AssociatedOpen in IMG/M
7000000052Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 404239096Host-AssociatedOpen in IMG/M
7000000062Human subgingival plaque microbial communities from NIH, USA - visit 2, subject 764042746Host-AssociatedOpen in IMG/M
7000000104Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765034022Host-AssociatedOpen in IMG/M
7000000118Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158944319Host-AssociatedOpen in IMG/M
7000000126Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763982056Host-AssociatedOpen in IMG/M
7000000132Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158337416Host-AssociatedOpen in IMG/M
7000000140Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 550534656Host-AssociatedOpen in IMG/M
7000000147Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763961826Host-AssociatedOpen in IMG/M
7000000182Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765640925Host-AssociatedOpen in IMG/M
7000000194Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158337416Host-AssociatedOpen in IMG/M
7000000197Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160603188Host-AssociatedOpen in IMG/M
7000000205Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 158742018Host-AssociatedOpen in IMG/M
7000000221Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 763820215Host-AssociatedOpen in IMG/M
7000000228Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158499257Host-AssociatedOpen in IMG/M
7000000244Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159915365Host-AssociatedOpen in IMG/M
7000000286Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159510762Host-AssociatedOpen in IMG/M
7000000298Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159915365Host-AssociatedOpen in IMG/M
7000000313Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 604812005Host-AssociatedOpen in IMG/M
7000000316Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160502038Host-AssociatedOpen in IMG/M
7000000369Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764811490Host-AssociatedOpen in IMG/M
7000000371Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159814214Host-AssociatedOpen in IMG/M
7000000392Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158802708Host-AssociatedOpen in IMG/M
7000000393Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765337473Host-AssociatedOpen in IMG/M
7000000398Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159571453Host-AssociatedOpen in IMG/M
7000000404Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158499257Host-AssociatedOpen in IMG/M
7000000411Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 638754422Host-AssociatedOpen in IMG/M
7000000440Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763435843Host-AssociatedOpen in IMG/M
7000000457Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159571453Host-AssociatedOpen in IMG/M
7000000472Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 861967750Host-AssociatedOpen in IMG/M
7000000494Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158479027Host-AssociatedOpen in IMG/M
7000000574Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160582958Host-AssociatedOpen in IMG/M
7000000583Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160643649Host-AssociatedOpen in IMG/M
7000000605Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763961826Host-AssociatedOpen in IMG/M
7000000606Human subgingival plaque microbial communities from NIH, USA - visit 2, subject 763961826Host-AssociatedOpen in IMG/M
7000000618Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 763536994Host-AssociatedOpen in IMG/M
7000000631Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 338793263Host-AssociatedOpen in IMG/M
7000000653Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160421117Host-AssociatedOpen in IMG/M
7000000676Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765013792Host-AssociatedOpen in IMG/M
7000000700Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 158944319Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0099581_13762423300006319HumanALTSLPPPPQWGWRGGGAKLFLLGGYLAIPIRCPFFAQALKETLSQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0102522_11626913300006898HumanVSGQCGAKLFLLGGYLAIPICRPFFAQALKETLSQERSLGDAYDKDYQNEKALQWIHRRHILGI
Ga0102683_12588713300007122HumanHIVSGQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0103291_12783813300007208HumanSPHIVATQCGAKLFLLGGYLAVPIRRPFFAKALKETLGQERGLGDTYDKDYQNEKALQWVHRRHILGICKEE*
Ga0104869_10955533300007268HumanIPIRRPFFAQALKKTLGQARSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0104867_1001300103300007295HumanVSAQCGAKLFLWGGYLAIPIRCPFFAQALKKTLGQERGLGDAYDKDYQNEKALQWIHRRRILGICKEE*
Ga0104793_11222523300007297HumanVSAQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0104843_10172113300007300HumanVSAQCGAKLFLLGGYLAIPICRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0104922_100048693300007316HumanVSGQCGAKLFLLGGYLAIPIRCPFFAQALKKTLGQERGLGDAYDKDYQNEKALQWIHRRRILGICKEE*
Ga0104925_10041283300007318HumanVPAQCGAKLFLLGGYLTVPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0104971_10029263300007339HumanVSAQCGAKLFLLGGYLAIPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0104762_100007153300007355HumanLGGYLAVPIRRPFFAQSLKKTLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0104973_10030983300007367HumanVSGQCGAKLFLLGGYLAIPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0104977_100595343300007368HumanVSGQCGAKLFLLGGYLAIPICRPFFAQALKETLSQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0104970_101910513300007566HumanVSGQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0105526_1000192123300007638HumanVSGQCGAKLFLLGGYLAIPICRPFFAKALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0105538_10012983300007660HumanVSGQCGAKLFLLGGYLAIPICRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0105539_10182113300007662HumanLGGYLAVPIRRPFFAQALKETLGQERSLGDAYDKGYQNEKALQWIH*
Ga0105541_100846423300007663HumanVSGQCGAKLFLLGGYLAIPICRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0105757_101762313300007736HumanGGGGGAKLFLLGGYLAIPICRPFFAQAPKETLSQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0105776_1000396133300007746HumanLGGYLAVPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0105780_10298463300007803HumanLFLGGYLAIPICRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0105961_11529913300007828HumanEGRRGGGGKRFLLGGYLAVPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHQRHILGICKEE*
Ga0114251_11276213300007938HumanPPPPLWGGKGGGAKLFLLGGYLAIPISRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0105969_10941023300007968HumanVSGQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERGLRDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0111056_10122433300008061HumanVSGQCGAKLFLWGGYLALLILRPFFAKAPKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0114852_12204213300008074HumanGGRGRGGGRLFLLGGYLAIPIRCPFFAQALKKTLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0105957_13689913300008080HumanLGGYLAVPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0114309_10127543300008090HumanLGGYLALLILRPFFAKAPKETLGQERGLGDAYDKDYQNEKALQWIHRCHILGICKKE*
Ga0114854_10089543300008123HumanVGLQCGAKLFLWGGYLAIPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRCHILGICKEE*
Ga0114844_101656113300008126HumanLGGYLAVPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHQRHILGICKEE*
Ga0114846_11964713300008127HumanSLGVAGSEGAAKLFLLGGYLAIPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0114847_10893733300008128HumanVSGQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERGLRDAYDKDYQNEKALQWVHRRHILGICKEE*
Ga0111365_12693613300008133HumanVSGQCGAKLFLLGGYLAIPIRCPFFAQALKKTLGQARSLGDAYDKDYQNEKALQWIHRRRILGICKEE*
Ga0113979_11271323300008136HumanVSGQCGAKLFLLGGYLAIPICRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRHHILGICKEE*
Ga0114286_101084633300008142HumanVPTQCGAKLFLLGSYLAIPICRPFFAKAPKETLGQERSLGDAYDKDYQNEKALQWIHRCHILGICKEE*
Ga0114284_100679153300008144HumanVSGQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0114001_10853853300008155HumanVSLQCGAKLFLWGGYLAIPIRRPFSAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0114154_10494943300008269HumanLGGYLAIPICRPFFAKALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0111085_1000181323300008271HumanLGGYLAIPIRRPFFAQTLKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0114262_12855913300008278HumanVSAQCGAKLFLLVGYLAIPIRRPFFAQALKETLSQERGLGDAYDKDYQNEKALQWIHRRRILGICKEE*
Ga0114263_100029073300008279HumanVSAQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRQILGICKEE*
Ga0114874_10521913300008302HumanLRPPPRPCFAYAGCVAGRLFLLGGYLAIPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRQILGICKEE*
Ga0114894_10594523300008331HumanVSAQCGAKLFLLGGYLAIPICRPFFAKALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0114890_11787323300008364HumanVFLLGGYLAVPIRRPFFAQSLKKTLGQERGLGDAYDKDYQNEKALQWIHQRHILGICKEE
Ga0115224_100192543300008406HumanLGGYLAIPIRCPFFAKAPKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0115228_14204623300008420HumanRLCCASRPPPPIVGAQGGGAKLFLLGGYLAVPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0115418_10539623300008436HumanLGGYLAIPIRCPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0115375_10084213300008474HumanAPPPPVGRQGGGAKLFLWGGYLAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0111007_10146863300008489HumanLGGYLAVPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0111009_101301423300008493HumanLGGYLAVPIRRPFFAKALKETLGQERGLGDTYDKDYQNEKALQWVHRRHILGICKEE*
Ga0115176_102130413300008506HumanLGGYLAIPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0115192_10239743300008521HumanLGGYLAIPIRRPFFAKALKKTLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0111050_10830323300008534HumanLGGYLAIPICRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWVHRRHILSICKEE*
Ga0111051_100293143300008537HumanLRGYLAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWVHRRHILGICKEE*
Ga0111061_100221153300008565HumanLGGYLAIPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0111559_1000085303300008688HumanLGGYLAIPICRPFFAKALKETLGQERSLGDAYDKDYQNEKALQWIH*
Ga0113557_12426323300008695HumanLGGYLAVPIRRPFFAQSLKKTLGQERGLGDAYDKDYQNEKALQWIHQRHILGICKEE*
Ga0115609_105393513300008715HumanCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKKE*
Ga0113876_13778113300008717HumanGATPPLFAAPRGGAKLFLWGGYLAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0113998_100683133300008734HumanLGGYLAVPIRCPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0115681_11262813300008749HumanVSGQCGAKLFLLGGYLAIPICRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0133749_1411713300009963Human Oral CavityPNALCTSPHIVSAQCGAKLFLFGGYLAIPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0133739_1360413300009964Human Oral CavityVSGQCGAKLFLLGGYLTIPIRCPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0119777_106854713300011980Human OralQCGAKLFLWGGYLAVPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0119816_105236313300014037Human OralKLFLLGGYLAIPICRPFFAKALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0119819_102342023300014038Human OralLFLLGGYLAIPICRPFFAKALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
Ga0134343_10708513300014090Human OralAPPPHLVGGNWGAKLFLLGGYLAIPICRPFFAQALKETLSQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*
SRS022530_LANL_scaffold_59194__gene_1555757000000001HumanVSAQCGAKLFLLGGYLAVPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
C4541841__gene_3085207000000005HumanNALRTSPHIVATQCGAKLFLWGGYLAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS022725_LANL_scaffold_97308__gene_2173547000000018HumanLGGYLAIPICRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS024138_Baylor_scaffold_9390__gene_103577000000028HumanLGGYLAIPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRRILGICKEE
SRS042131_WUGC_scaffold_55213__gene_929737000000029HumanLGGYLAIPICRPFFAKALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
C3041294__gene_1686097000000052HumanAKLFLLGGYLAIPICRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRHHILGICKEE
C2235392__gene_953307000000062HumanSGQCGAKLFLLGGYLAIPICRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS019225_WUGC_scaffold_33832__gene_461697000000104HumanLGGYLAIPICRPFFAQALKETLSQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS024289_LANL_scaffold_68997__gene_1011987000000118HumanAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
C1781156__gene_980297000000126HumanSGQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS012285_Baylor_scaffold_18783__gene_220447000000132HumanHIVATQCGAKLFLWGGYLAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS044373_WUGC_scaffold_34546__gene_435807000000140HumanHIVVTQCGAKLFLWGGYLALLILRPFFTKALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
C1860308__gene_915257000000147HumanRFLLGGYLAVPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHQRHILGICKEE
C2062548__gene_785187000000182HumanTQCGAKLFLLGGYLAVPIRRPFFAQSLKKTLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS022077_Baylor_scaffold_46639__gene_624587000000194HumanVSAQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS017808_Baylor_scaffold_12041__gene_121497000000197HumanSAQCGAKLFLLGGYLAIPICRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS011247_Baylor_scaffold_24036__gene_266467000000205HumanVPAQCGAKLFLLGGYLTVPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
C1247766__gene_353987000000221HumanGQCGAKLFLLGGYLAIPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS022602_Baylor_scaffold_42961__gene_487007000000228HumanVSGQCGAKLFLLGGYLAIPICRPFFAQALKETLSQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS016575_Baylor_scaffold_66762__gene_971677000000244HumanVSGQCGAKLFLLGGYLAIPICRPFFAKALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS024081_LANL_scaffold_7750__gene_112377000000286HumanVGLQCGAKLFLWGGYLAIPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRCHILGICKEE
SRS016569_Baylor_scaffold_18745__gene_242667000000298HumanVSGQCGAKLFLLGGYLAIPIRCPFFAQALKKTLGQERGLGDAYDKDYQNEKALQWIHRRRILGICKEE
SRS058053_LANL_scaffold_83394__gene_987277000000313HumanLGGYLAIPICRPFFAQAPKETLSQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS017511_Baylor_scaffold_79708__gene_947797000000316HumanLGGYLAVPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
C2089852__gene_1045257000000369HumanIVSGQCGAKLFLLGGYLAVPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS047113_LANL_scaffold_57537__gene_565837000000371HumanVPTQCGAKLFLLGSYLAIPICRPFFAKAPKETLGQERSLGDAYDKDYQNEKALQWIHRCHILGICKEE
SRS023557_Baylor_scaffold_27158__gene_340877000000392HumanLGGYLAIPICRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWVHRRHILSICKEE
SRS019327_WUGC_scaffold_39896__gene_600077000000393HumanLRGYLAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWVHRRHILGICKEE
SRS024470_LANL_scaffold_5696__gene_51767000000398HumanGAKLFLWGGYLALLILRPFFAKAPKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
C4306431__gene_1515777000000404HumanPTQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS042984_LANL_scaffold_13487__gene_179977000000411HumanLGGYLAIPIRRPFFAQTLKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS015797_WUGC_scaffold_34400__gene_432627000000440HumanVSGQCGAKLFLLGGYLAIPICRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRHH
SRS024447_LANL_scaffold_26951__gene_269087000000457HumanVSGQCGAKLFLWGGYLALLILRPFFAKAPKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS051244_LANL_scaffold_46583__gene_475447000000472HumanLGGYLAIPICRPFFAKALKETLGQERSLGDAYDKDYQNEKALQWIH
C2618103__gene_1784837000000494HumanLFLWGGYLAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS017691_Baylor_scaffold_77734__gene_945427000000574HumanLGGYLAVPIRRPFFAQSLKKTLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS019974_Baylor_scaffold_57175__gene_714317000000583HumanLGGYLALLILRPFFAKAPKETLGQERGLGDAYDKDYQNEKALQWIHRCHILGICKKE
SRS019028_WUGC_scaffold_51759__gene_604117000000605HumanHIVATQCGAKRFLLGGYLAVPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHQRHILGICKEE
C3251163__gene_1451747000000606HumanATQCGAKRFLLGGYLAVPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHQRHILGICKEE
SRS062544_LANL_scaffold_51124__gene_622247000000618HumanHIVSGQCGAKLFLLGGYLAIPICRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS050029_WUGC_scaffold_189__gene_1287000000631HumanAQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRQILGICKEE
SRS016740_Baylor_scaffold_61493__gene_740347000000653HumanLGGYLAVPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS018665_WUGC_scaffold_23797__gene_260877000000676HumanVSGQCGAKLFLLGGYLAIPICRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE
SRS011310_Baylor_scaffold_15757__gene_214087000000700HumanATQCGAKLFLWGGYLAIPIRRPFFAQALKETLGQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.