NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000606

7000000606: Human subgingival plaque microbial communities from NIH, USA - visit 2, subject 763961826



Overview

Basic Information
IMG/M Taxon OID7000000606 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053178 | Ga0030973
Sample NameHuman subgingival plaque microbial communities from NIH, USA - visit 2, subject 763961826
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size93860530
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae1
Not Available1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018385Metagenome235Y
F022002Metagenome216Y
F084342Metagenome112N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C3251163All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae647Open in IMG/M
C3271702Not Available824Open in IMG/M
SRS019029_WUGC_scaffold_17363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1131Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C3251163C3251163__gene_145174F084342ATQCGAKRFLLGGYLAVPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHQRHILGICKEE
C3271702C3271702__gene_154738F022002ISGFTLGVTTPAEARAIIQRQGGEIEETQAWSDEVVYAITGLKYARRPTLSVRLYFYKGHLRSISFVFGDLKIFEQIESELENKYGTMAEGKATSKMRVKGIADAFTSLEVVVHSFEYDGHVGFAYAYISYTDLELDRAYSAENEI
SRS019029_WUGC_scaffold_17363SRS019029_WUGC_scaffold_17363__gene_11051F018385MAEHVNRWDPYAEVPIETHRDPVKDDQLIYGVNVPHFTVTVYSPDGRVNKYWNARILEDMLGYCRIACPRDGKILKFKWSDWSVYMFTHDGLNDLVFMPDSGRKIITQLFEKEVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.