3300014090: Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_099

Overview

Basic Information

• IMG/M Taxon OID: 3300014090
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121296 | Gp0151515 | Ga0134343
• Sample Name: Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_099
• Sequencing Status: Permanent Draft
• Sequencing Center: The George Washington University (GWU)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 17899777
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal secretion

Location Information

• Location: USA: Maryland
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053092	Metagenome	141	N
F084342	Metagenome	112	N
F094006	Metagenome	106	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0134343_101554	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae	1514
Ga0134343_102683	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279	1109
Ga0134343_107085	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae	602

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134343_101554	Ga0134343_1015542	F094006	MRGTLEPAGSTGALYKPAVSMEAHIGELQTGGIARRGLFAFGGSNVLAVAELGAEAPRAINMYDIALCKPLSELFAKELEYAFNFGA*
Ga0134343_102683	Ga0134343_1026832	F053092	MQSAQGLILCLTHALLVLRALVLEPAEMEDTMDDHAVQLFGVLGAKELSITTHRNKTDEHVPRDHIPITLVEGDDIGIVVMIEKVLIGLQDALITTELVAELTDTTVIAGSDLTDPVAKDTLSEARLLDVFVSIVSYKLRFFRHK*
Ga0134343_107085	Ga0134343_1070851	F084342	APPPHLVGGNWGAKLFLLGGYLAIPICRPFFAQALKETLSQERSLGDAYDKDYQNEKALQWIHRRHILGICKEE*