| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000205 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052717 | Ga0027920 |
| Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 158742018 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 29684592 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 2 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043235 | Metagenome | 156 | N |
| F047508 | Metagenome | 149 | N |
| F084342 | Metagenome | 112 | N |
| F090517 | Metagenome | 108 | N |
| F094006 | Metagenome | 106 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C1368854 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| SRS011247_Baylor_scaffold_13865 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas | 1970 | Open in IMG/M |
| SRS011247_Baylor_scaffold_23776 | All Organisms → cellular organisms → Bacteria | 4519 | Open in IMG/M |
| SRS011247_Baylor_scaffold_24036 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae | 1588 | Open in IMG/M |
| SRS011247_Baylor_scaffold_24502 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae | 3870 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C1368854 | C1368854__gene_57358 | F047508 | ARTVEAIATDAVLVIEFVGEPVHIGMLGHRLVEGCVKYPYLRRIGEYLRHSFDTEDVGWVVKRSKLCALMEHIYYLWGDTYALSKALCTVYEAVTDGVDLIEGLYEVLFFENVEDNLYAACVVRNVKVALNLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELDEGELQGGAATVEDQDFHKVLYYMVRCELILSSP |
| SRS011247_Baylor_scaffold_13865 | SRS011247_Baylor_scaffold_13865__gene_12854 | F090517 | MNRRILSFCGLLLGLLFLASSCKSKKDTPRLQLSSVELRQTAWYGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTDSQVRYYYTITDGIFTLKAQVNRELHPQMDQDTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL |
| SRS011247_Baylor_scaffold_23776 | SRS011247_Baylor_scaffold_23776__gene_26064 | F043235 | VQAQIFSLSQALKHGIGDCPDTDLKRISIVDEFSTQLTDALLDRPDGSKRELHQGAVNGDDIVQLRHMDEVVPSDEGHLLIDLCDDDPRRLRSGLGIVTRHPEGAIALFIGLAHRDQCDIDRIDTIPKEVWEFMEVTREIVYSLIQVSGAAILVKEVKDGMYMPYHLWAEVPRLGKVQHVEGFHVREALAIIVEGFGEAAGGCHSMAKDQEVPALYCRSHGFEGGRSMASNVLFPGSAH |
| SRS011247_Baylor_scaffold_24036 | SRS011247_Baylor_scaffold_24036__gene_26646 | F084342 | VPAQCGAKLFLLGGYLTVPIRRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE |
| SRS011247_Baylor_scaffold_24502 | SRS011247_Baylor_scaffold_24502__gene_27485 | F094006 | MWSALEPAGPTGALYESAVCVEAHIGYLQTGGIACRGLFAFGRRDLLAVAELGAEAPHAINMYDIALCKPLSELF |
| ⦗Top⦘ |