3300007660: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159915365 reassembly

Overview

Basic Information

• IMG/M Taxon OID: 3300007660
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0052772 | Ga0105538
• Sample Name: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159915365 reassembly
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 33320797
• Sequencing Scaffolds: 5
• Novel Protein Genes: 5
• Associated Families: 5

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae	1
All Organisms → Viruses → Predicted Viral	1
Not Available	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047508	Metagenome	149	N
F053092	Metagenome	141	N
F077405	Metagenome	117	N
F077781	Metagenome / Metatranscriptome	117	N
F084342	Metagenome	112	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0105538_100129	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279	13799
Ga0105538_101805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae	2162
Ga0105538_101838	All Organisms → Viruses → Predicted Viral	2129
Ga0105538_103337	Not Available	1433
Ga0105538_111095	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan	674

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0105538_100129	Ga0105538_1001298	F084342	VSGQCGAKLFLLGGYLAIPICRPFFAKALKETLGQERGLGDAYDKDYQNEKALQWIHRRHILGICKEE*
Ga0105538_101805	Ga0105538_1018054	F077405	LLVAKQRGVFYGFISLCQIKFVKKVFDWLKIIQK*
Ga0105538_101838	Ga0105538_1018381	F053092	CRCLSPRLLVRGALILEPAEMEDTMDDHAVQLFGVLGAKELSITTHRIKTDEHVPRDHIPITLVEGDDIGIVVMIEKVLIGLQDALITTELVAELADTTVIASSDLTDPVAKDTLSEARLLDVFVSIVSYKLRFFRHK*
Ga0105538_103337	Ga0105538_1033371	F047508	VVELIGEPVHIGMLGHRLVEGCVKYPYLRRIGEYLRHSFDTEDVGWVVKRSKLCALMEHIYYLWGDTYALSKALCTVYEAMTDGVDLIEGLYEVLFFENVEDNLYAACVVRNVKVALNLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELDEGELQGGATTVEDQDFHKVLYYMVRCELILSSP*
Ga0105538_111095	Ga0105538_1110951	F077781	LRPTFCSATGTPPPIAAPARPAPAHLKAPAAVTGGWGSPRQNDFFILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRTADSLYLGFPRPHPGTPGLGRFWPFLALQSLSETPSHARMPRVTVARTSPETLEISPLRAAT*