| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000631 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053206 | Ga0028017 |
| Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 338793263 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 26246782 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 2 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | National Institutes of Health, USA | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045567 | Metagenome | 152 | N |
| F051213 | Metagenome | 144 | N |
| F084342 | Metagenome | 112 | N |
| F098763 | Metagenome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SRS050029_WUGC_scaffold_10650 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 2714 | Open in IMG/M |
| SRS050029_WUGC_scaffold_189 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae | 646 | Open in IMG/M |
| SRS050029_WUGC_scaffold_6986 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 5942 | Open in IMG/M |
| SRS050029_WUGC_scaffold_8353 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas | 1199 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SRS050029_WUGC_scaffold_10650 | SRS050029_WUGC_scaffold_10650__gene_15396 | F045567 | MCQRDGRDTLTEELEGGITPLLYRAEGEARRPWVGMVTEDVVHTSTHRVEDALLPVDGDILTPRDGTHIVQTERVVVVLVSQEDSIDTIDTEACGLVVEVRATVDEDTLPTLGDDEGRGAQTTVTSIRAMAHRAATAYLGDTSAGARTEKNYLHVSRRESYHGKERPSLSSERGCVVERVVR |
| SRS050029_WUGC_scaffold_189 | SRS050029_WUGC_scaffold_189__gene_128 | F084342 | AQCGAKLFLLGGYLAIPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHRRQILGICKEE |
| SRS050029_WUGC_scaffold_6986 | SRS050029_WUGC_scaffold_6986__gene_8567 | F098763 | MDGRTSLRVLSPALYLATKLFEAVVWTTIADDSRDEVEGKGGMNAVPTAVDE |
| SRS050029_WUGC_scaffold_8353 | SRS050029_WUGC_scaffold_8353__gene_10490 | F051213 | MKASKLLWAVVVALSFVFTSCDWVGDEPTIEGKLDKFFDSQAQRKSFRILTGSGKPYNHKVDWHIIGITDPYSDTYLTKKVDTLSNGDLKISYDWVSFTVRENKSVIDVEVQKNETGKVRAVYLNTSTSGRHITLPDMRVTQRAK |
| ⦗Top⦘ |