7000000147: Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763961826

Overview

Basic Information

• IMG/M Taxon OID: 7000000147
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0052643 | Ga0031014
• Sample Name: Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763961826
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 67403126
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria sicca	1
All Organisms → cellular organisms → Bacteria	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047508	Metagenome	149	N
F054111	Metagenome	140	N
F084342	Metagenome	112	N

Associated Scaffolds

Scaffold	Taxonomy	Length
C1857140	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria sicca	614
C1857626	All Organisms → cellular organisms → Bacteria	618
C1860308	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas somerae	639

Sequences

Scaffold ID	Protein ID	Family	Sequence
C1857140	C1857140__gene_90063	F047508	GHRLVEGRVKYPYLRRIGEYLRHSFDTEDVGWVVKRSKLCALMEHIYYLWGDTYALSKALCTVYEAVTNGIDLIEGLYEVLFFKNVEDNLYAACVVRNVKVALNLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELDEGELQGGAATVEDQDFHKVLYYMVRCELILSSP
C1857626	C1857626__gene_90286	F054111	MNKSLESITHEEFLKLMEHLKNLQEFTFLEYIMAPEADIFHFNFMEKNLKIKWDLDYGLFLETESLSTADRD
C1860308	C1860308__gene_91525	F084342	RFLLGGYLAVPIRRPFFAQALKETLGQERGLGDAYDKDYQNEKALQWIHQRHILGICKEE