NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F073671

Metagenome Family F073671

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073671
Family Type Metagenome
Number of Sequences 120
Average Sequence Length 45 residues
Representative Sequence MNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK
Number of Associated Samples 113
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 72.50 %
% of genes near scaffold ends (potentially truncated) 5.83 %
% of genes from short scaffolds (< 2000 bps) 21.67 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.167 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human
(68.333 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
(93.333 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Mixed Signal Peptide: No Secondary Structure distribution: α-helix: 84.44%    β-sheet: 0.00%    Coil/Unstructured: 15.56%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF00436SSB 13.33
PF03837RecT 5.83
PF10552ORF6C 5.00
PF04381RdgC 5.00
PF04448DUF551 4.17
PF13649Methyltransf_25 3.33
PF03406Phage_fiber_2 3.33
PF14464Prok-JAB 2.50
PF00145DNA_methylase 2.50
PF06289FlbD 2.50
PF10548P22_AR_C 2.50
PF00224PK 2.50
PF11041DUF2612 1.67
PF14301DUF4376 1.67
PF00005ABC_tran 1.67
PF03819MazG 1.67
PF07715Plug 1.67
PF12821ThrE_2 0.83
PF06472ABC_membrane_2 0.83
PF05065Phage_capsid 0.83
PF03592Terminase_2 0.83
PF04865Baseplate_J 0.83
PF10108DNA_pol_B_exo2 0.83
PF09003Arm-DNA-bind_1 0.83
PF10828DUF2570 0.83
PF05930Phage_AlpA 0.83
PF01479S4 0.83
PF05766NinG 0.83
PF01381HTH_3 0.83
PF03796DnaB_C 0.83
PF13856Gifsy-2 0.83
PF01936NYN 0.83
PF02086MethyltransfD12 0.83
PF12008EcoR124_C 0.83
PF13986DUF4224 0.83
PF01416PseudoU_synth_1 0.83
PF05100Phage_tail_L 0.83
PF01168Ala_racemase_N 0.83
PF13392HNH_3 0.83
PF04851ResIII 0.83
PF04358DsrC 0.83
PF08861DUF1828 0.83
PF00582Usp 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 13.33
COG2965Primosomal replication protein NReplication, recombination and repair [L] 13.33
COG3723Recombinational DNA repair protein RecTReplication, recombination and repair [L] 5.83
COG2974DNA recombination-dependent growth factor RdgCReplication, recombination and repair [L] 5.00
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 2.50
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 2.50
COG1582Swarming motility protein SwrDCell motility [N] 2.50
COG4672Phage tail proteinMobilome: prophages, transposons [X] 0.83
COG0101tRNA U38,U39,U40 pseudouridine synthase TruATranslation, ribosomal structure and biogenesis [J] 0.83
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.83
COG3728Phage terminase, small subunitMobilome: prophages, transposons [X] 0.83
COG3392Adenine-specific DNA methylaseReplication, recombination and repair [L] 0.83
COG3311DNA-binding transcriptional regulator AlpATranscription [K] 0.83
COG2920Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C)Translation, ribosomal structure and biogenesis [J] 0.83
COG1432NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturationGeneral function prediction only [R] 0.83
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.83
COG0338DNA-adenine methylaseReplication, recombination and repair [L] 0.83
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.33 %
UnclassifiedrootN/A11.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908012|sp300_12631222All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae3163Open in IMG/M
3300006247|Ga0099374_1000028All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus143963Open in IMG/M
3300006248|Ga0099387_100003All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae182519Open in IMG/M
3300006251|Ga0099392_102691All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae5803Open in IMG/M
3300006254|Ga0099365_1000039All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae43402Open in IMG/M
3300006259|Ga0099458_100116All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus79037Open in IMG/M
3300006261|Ga0099521_100001All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae564764Open in IMG/M
3300006292|Ga0099622_100318All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus38321Open in IMG/M
3300006319|Ga0099581_100219All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae46774Open in IMG/M
3300006319|Ga0099581_100223All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae46376Open in IMG/M
3300006321|Ga0099624_100228All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus55379Open in IMG/M
3300006348|Ga0099694_100664All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae12907Open in IMG/M
3300006457|Ga0100214_100163All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae22185Open in IMG/M
3300006460|Ga0100061_100098All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus83170Open in IMG/M
3300006477|Ga0100232_117876All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae1242Open in IMG/M
3300006489|Ga0100254_100231All Organisms → Viruses8135Open in IMG/M
3300006678|Ga0100058_100244All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae50363Open in IMG/M
3300007079|Ga0104033_100373All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus24939Open in IMG/M
3300007096|Ga0102538_102800All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae5920Open in IMG/M
3300007125|Ga0102700_1000240All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae54424Open in IMG/M
3300007125|Ga0102700_1011670All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus3237Open in IMG/M
3300007128|Ga0102725_100081All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae48341Open in IMG/M
3300007135|Ga0102639_100004All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae192887Open in IMG/M
3300007186|Ga0103259_109135All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus haemolyticus2551Open in IMG/M
3300007194|Ga0103269_100346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae39069Open in IMG/M
3300007204|Ga0103275_100003All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae281336Open in IMG/M
3300007278|Ga0104339_104482All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae847Open in IMG/M
3300007295|Ga0104867_1001063All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae15152Open in IMG/M
3300007300|Ga0104843_100193All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae48138Open in IMG/M
3300007314|Ga0104968_100220All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae40878Open in IMG/M
3300007316|Ga0104922_103052All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae8077Open in IMG/M
3300007339|Ga0104971_100081All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae46570Open in IMG/M
3300007648|Ga0105531_100497All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae28655Open in IMG/M
3300007736|Ga0105757_1000081All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus45821Open in IMG/M
3300007753|Ga0105778_100652All Organisms → cellular organisms → Bacteria11686Open in IMG/M
3300007869|Ga0111024_101618All Organisms → Viruses → Predicted Viral4148Open in IMG/M
3300007971|Ga0114094_1029419Not Available610Open in IMG/M
3300007996|Ga0111052_101883All Organisms → Viruses12031Open in IMG/M
3300008099|Ga0114261_105895All Organisms → Viruses → Predicted Viral3407Open in IMG/M
3300008125|Ga0114856_1010584Not Available2963Open in IMG/M
3300008128|Ga0114847_114071Not Available1205Open in IMG/M
3300008133|Ga0111365_100238All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae48058Open in IMG/M
3300008133|Ga0111365_145708Not Available516Open in IMG/M
3300008138|Ga0114843_100165All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae43765Open in IMG/M
3300008143|Ga0114287_100318All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae33416Open in IMG/M
3300008147|Ga0114367_101939All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus10060Open in IMG/M
3300008270|Ga0114159_101031All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus4361Open in IMG/M
3300008274|Ga0114252_102840All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus haemolyticus3681Open in IMG/M
3300008279|Ga0114263_1001214Not Available8897Open in IMG/M
3300008305|Ga0115183_100074All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae41224Open in IMG/M
3300008333|Ga0115302_100087All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus69251Open in IMG/M
3300008333|Ga0115302_101121All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae13847Open in IMG/M
3300008403|Ga0115182_100602All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus15940Open in IMG/M
3300008436|Ga0115418_100271All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus45100Open in IMG/M
3300008472|Ga0115373_1027788All Organisms → Viruses → Predicted Viral1017Open in IMG/M
3300008518|Ga0115191_100217All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus51604Open in IMG/M
3300008556|Ga0111059_102969All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae5636Open in IMG/M
3300008626|Ga0111364_100202All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae43137Open in IMG/M
3300008660|Ga0111492_102844All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus4027Open in IMG/M
3300008732|Ga0113984_103311All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae3414Open in IMG/M
3300008739|Ga0114021_135554Not Available675Open in IMG/M
3300009954|Ga0133740_10010All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus33459Open in IMG/M
3300009961|Ga0133745_10165All Organisms → Viruses → Predicted Viral3567Open in IMG/M
3300011967|Ga0119781_116906Not Available825Open in IMG/M
3300011982|Ga0119773_1006132All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae3358Open in IMG/M
3300014108|Ga0134359_1007993All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus1327Open in IMG/M
3300014951|Ga0169829_100265All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus64437Open in IMG/M
3300029479|Ga0244137_100259All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus64123Open in IMG/M
3300029679|Ga0243220_103444All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus4703Open in IMG/M
7000000005|SRS022536_LANL_scaffold_112765All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae6475Open in IMG/M
7000000009|SRS018300_Baylor_scaffold_43448All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae3659Open in IMG/M
7000000016|SRS023538_Baylor_scaffold_41056All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae1455Open in IMG/M
7000000025|SRS023617_Baylor_scaffold_29664All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria18902Open in IMG/M
7000000027|C2568910All Organisms → Viruses → Predicted Viral2812Open in IMG/M
7000000029|SRS042131_WUGC_scaffold_53336All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae3948Open in IMG/M
7000000033|SRS019333_WUGC_scaffold_16267All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae4422Open in IMG/M
7000000039|C2361491All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae2267Open in IMG/M
7000000042|C3788548Not Available566Open in IMG/M
7000000051|C1816283All Organisms → Viruses → Predicted Viral1139Open in IMG/M
7000000086|C4112281All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Myoviridae sp. ctVKV3671Open in IMG/M
7000000099|C3289035Not Available1277Open in IMG/M
7000000110|SRS011098_Baylor_scaffold_27433All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria19634Open in IMG/M
7000000128|SRS050244_LANL_scaffold_36247All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae541Open in IMG/M
7000000132|SRS012285_Baylor_scaffold_55315All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae5095Open in IMG/M
7000000140|SRS044373_WUGC_scaffold_60621All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae8138Open in IMG/M
7000000144|C4869098All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae1454Open in IMG/M
7000000159|SRS063288_LANL_scaffold_63181All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae4264Open in IMG/M
7000000180|SRS017013_Baylor_scaffold_23037All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae898Open in IMG/M
7000000180|SRS017013_Baylor_scaffold_23698All Organisms → Viruses → Predicted Viral3678Open in IMG/M
7000000195|SRS017209_Baylor_scaffold_24281All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4817Open in IMG/M
7000000197|SRS017808_Baylor_scaffold_3102All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae4103Open in IMG/M
7000000203|SRS024441_LANL_scaffold_56521All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae3293Open in IMG/M
7000000222|SRS057539_LANL_scaffold_23351All Organisms → Viruses41991Open in IMG/M
7000000276|SRS054687_LANL_scaffold_48704All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae16425Open in IMG/M
7000000295|SRS019219_WUGC_scaffold_66328All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae18292Open in IMG/M
7000000301|SRS016092_WUGC_scaffold_6431All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae45259Open in IMG/M
7000000313|SRS058053_LANL_scaffold_56837All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae1076Open in IMG/M
7000000394|SRS019607_WUGC_scaffold_57356All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae11791Open in IMG/M
7000000402|SRS024580_LANL_scaffold_42492All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae7622Open in IMG/M
7000000436|SRS015644_WUGC_scaffold_3027All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae15425Open in IMG/M
7000000457|C3994762All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae9696Open in IMG/M
7000000488|SRS016529_Baylor_scaffold_4770All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae4443Open in IMG/M
7000000504|C2689454Not Available726Open in IMG/M
7000000513|C2450981Not Available903Open in IMG/M
7000000519|SRS018357_Baylor_scaffold_41345All Organisms → Viruses → Predicted Viral3883Open in IMG/M
7000000523|SRS019126_WUGC_scaffold_42151All Organisms → Viruses39231Open in IMG/M
7000000537|C1180083All Organisms → Viruses → Predicted Viral2436Open in IMG/M
7000000553|C2408155All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae11541Open in IMG/M
7000000561|SRS057355_LANL_scaffold_33617Not Available569Open in IMG/M
7000000561|SRS057355_LANL_scaffold_40971All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae1887Open in IMG/M
7000000563|C2625508All Organisms → Viruses → Predicted Viral2718Open in IMG/M
7000000576|C4123271All Organisms → cellular organisms → Bacteria5737Open in IMG/M
7000000599|C2620538Not Available587Open in IMG/M
7000000604|SRS019894_WUGC_scaffold_9248All Organisms → Viruses43120Open in IMG/M
7000000618|C3029880All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae2423Open in IMG/M
7000000656|C1354017All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales1135Open in IMG/M
7000000658|SRS018969_WUGC_scaffold_56897All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1209Open in IMG/M
7000000665|SRS016037_WUGC_scaffold_40989All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae4388Open in IMG/M
7000000665|SRS016037_WUGC_scaffold_43873All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae4435Open in IMG/M
7000000698|C3750397Not Available864Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
HumanHost-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human68.33%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human15.83%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human6.67%
Human FecalHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal1.67%
Human Oral CavityHost-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral Cavity1.67%
Human Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated0.83%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral0.83%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Saliva → Human0.83%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Palatine Tonsils → Human0.83%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral0.83%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral0.83%
Subgingival PlaqueHost-Associated → Human → Digestive System → Oral Cavity → Unclassified → Subgingival Plaque0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908012Human Subgingival plaque microbiome from visit number 1 of subject 763496533Host-AssociatedOpen in IMG/M
3300006247Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159005010Host-AssociatedOpen in IMG/M
3300006248Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 246515023Host-AssociatedOpen in IMG/M
3300006251Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159369152Host-AssociatedOpen in IMG/M
3300006254Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 706846339Host-AssociatedOpen in IMG/M
3300006259Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765034022Host-AssociatedOpen in IMG/M
3300006261Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764588959Host-AssociatedOpen in IMG/M
3300006292Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 809635352Host-AssociatedOpen in IMG/M
3300006319Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764062976Host-AssociatedOpen in IMG/M
3300006321Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160380657Host-AssociatedOpen in IMG/M
3300006348Human supragingival plaque microbial communities from NIH, USA - visit 2 of subject 158802708Host-AssociatedOpen in IMG/M
3300006457Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765337473Host-AssociatedOpen in IMG/M
3300006460Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 764143897Host-AssociatedOpen in IMG/M
3300006477Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 158883629Host-AssociatedOpen in IMG/M
3300006489Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764487809Host-AssociatedOpen in IMG/M
3300006678Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 159005010Host-AssociatedOpen in IMG/M
3300007079Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 809635352Host-AssociatedOpen in IMG/M
3300007096Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 604812005Host-AssociatedOpen in IMG/M
3300007125Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 675950834Host-AssociatedOpen in IMG/M
3300007128Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159207311Host-AssociatedOpen in IMG/M
3300007135Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158458797Host-AssociatedOpen in IMG/M
3300007186Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 246515023Host-AssociatedOpen in IMG/M
3300007194Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 550534656Host-AssociatedOpen in IMG/M
3300007204Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763961826Host-AssociatedOpen in IMG/M
3300007278Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160319967 reassemblyHost-AssociatedOpen in IMG/M
3300007295Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159814214 reassemblyHost-AssociatedOpen in IMG/M
3300007300Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160603188 reassemblyHost-AssociatedOpen in IMG/M
3300007314Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 861967750 reassemblyHost-AssociatedOpen in IMG/M
3300007316Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159571453 reassemblyHost-AssociatedOpen in IMG/M
3300007339Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763820215 reassemblyHost-AssociatedOpen in IMG/M
3300007648Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764588959 reassemblyHost-AssociatedOpen in IMG/M
3300007736Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 604812005 reassemblyHost-AssociatedOpen in IMG/M
3300007753Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159591683 reassemblyHost-AssociatedOpen in IMG/M
3300007869Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764305738 reassemblyHost-AssociatedOpen in IMG/M
3300007971Human saliva microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300007996Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765620695 reassemblyHost-AssociatedOpen in IMG/M
3300008099Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763820215 reassemblyHost-AssociatedOpen in IMG/M
3300008125Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 763536994 reassemblyHost-AssociatedOpen in IMG/M
3300008128Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159713063 reassemblyHost-AssociatedOpen in IMG/M
3300008133Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763840445 reassemblyHost-AssociatedOpen in IMG/M
3300008138Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764892411 reassemblyHost-AssociatedOpen in IMG/M
3300008143Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158499257 reassemblyHost-AssociatedOpen in IMG/M
3300008147Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763961826 replicate 1 reassemblyHost-AssociatedOpen in IMG/M
3300008270Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159369152 reassemblyHost-AssociatedOpen in IMG/M
3300008274Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764042746 reassemblyHost-AssociatedOpen in IMG/M
3300008279Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 338793263 reassemblyHost-AssociatedOpen in IMG/M
3300008305Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159753524 replicate 1 reassemblyHost-AssociatedOpen in IMG/M
3300008333Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 508703490 reassemblyHost-AssociatedOpen in IMG/M
3300008403Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764042746 reassemblyHost-AssociatedOpen in IMG/M
3300008436Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 370425937 reassemblyHost-AssociatedOpen in IMG/M
3300008472Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159551223 reassemblyHost-AssociatedOpen in IMG/M
3300008518Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764508039 reassemblyHost-AssociatedOpen in IMG/M
3300008556Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159591683 reassemblyHost-AssociatedOpen in IMG/M
3300008626Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764487809 reassemblyHost-AssociatedOpen in IMG/M
3300008660Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 604812005 reassemblyHost-AssociatedOpen in IMG/M
3300008732Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159611913 reassemblyHost-AssociatedOpen in IMG/M
3300008739Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 737052003 reassemblyHost-AssociatedOpen in IMG/M
3300009954Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 6Host-AssociatedOpen in IMG/M
3300009961Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 14Host-AssociatedOpen in IMG/M
3300011967Human oral microbial communities from Los Angeles, CA, USA - S03-01-DHost-AssociatedOpen in IMG/M
3300011982Human oral microbial communities from Beijing, China - VLP3Host-AssociatedOpen in IMG/M
3300014108Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_024Host-AssociatedOpen in IMG/M
3300014951Human fecal microbial communities from infant at 12 months in Denmark - 599_12MHost-AssociatedOpen in IMG/M
3300029479Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001894-56Host-AssociatedOpen in IMG/M
3300029679Human fecal microbial communities from healthy subjects in Hangzhou, China - HD-50_Run5Host-AssociatedOpen in IMG/M
7000000005Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 809635352Host-AssociatedOpen in IMG/M
7000000009Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160380657Host-AssociatedOpen in IMG/M
7000000016Human supragingival plaque microbial communities from NIH, USA - visit 2 of subject 158802708Host-AssociatedOpen in IMG/M
7000000025Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 159005010Host-AssociatedOpen in IMG/M
7000000027Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 764143897Host-AssociatedOpen in IMG/M
7000000029Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 764487809Host-AssociatedOpen in IMG/M
7000000033Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765337473Host-AssociatedOpen in IMG/M
7000000039Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159369152Host-AssociatedOpen in IMG/M
7000000042Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 158883629Host-AssociatedOpen in IMG/M
7000000051Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764487809Host-AssociatedOpen in IMG/M
7000000086Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159227541Host-AssociatedOpen in IMG/M
7000000099Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 604812005Host-AssociatedOpen in IMG/M
7000000110Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158458797Host-AssociatedOpen in IMG/M
7000000128Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 675950834Host-AssociatedOpen in IMG/M
7000000132Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158337416Host-AssociatedOpen in IMG/M
7000000140Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 550534656Host-AssociatedOpen in IMG/M
7000000144Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 246515023Host-AssociatedOpen in IMG/M
7000000159Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 809635352Host-AssociatedOpen in IMG/M
7000000180Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159490532Host-AssociatedOpen in IMG/M
7000000195Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159814214Host-AssociatedOpen in IMG/M
7000000197Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160603188Host-AssociatedOpen in IMG/M
7000000203Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159571453Host-AssociatedOpen in IMG/M
7000000222Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 861967750Host-AssociatedOpen in IMG/M
7000000276Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 706846339Host-AssociatedOpen in IMG/M
7000000295Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765034022Host-AssociatedOpen in IMG/M
7000000301Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764588959Host-AssociatedOpen in IMG/M
7000000313Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 604812005Host-AssociatedOpen in IMG/M
7000000394Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765620695Host-AssociatedOpen in IMG/M
7000000402Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159591683Host-AssociatedOpen in IMG/M
7000000436Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764487809Host-AssociatedOpen in IMG/M
7000000457Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159571453Host-AssociatedOpen in IMG/M
7000000488Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159753524 replicate 2Host-AssociatedOpen in IMG/M
7000000504Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159611913Host-AssociatedOpen in IMG/M
7000000513Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 737052003Host-AssociatedOpen in IMG/M
7000000519Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160178356Host-AssociatedOpen in IMG/M
7000000523Human palatine tonsils microbial communities from NIH, USA - visit 2, subject 763496533Host-AssociatedOpen in IMG/M
7000000537Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159369152Host-AssociatedOpen in IMG/M
7000000553Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764042746Host-AssociatedOpen in IMG/M
7000000561Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763860675Host-AssociatedOpen in IMG/M
7000000563Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763820215Host-AssociatedOpen in IMG/M
7000000576Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158499257Host-AssociatedOpen in IMG/M
7000000599Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763961826 replicate 1Host-AssociatedOpen in IMG/M
7000000604Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764892411Host-AssociatedOpen in IMG/M
7000000618Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 763536994Host-AssociatedOpen in IMG/M
7000000656Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764042746Host-AssociatedOpen in IMG/M
7000000658Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764305738Host-AssociatedOpen in IMG/M
7000000665Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764508039Host-AssociatedOpen in IMG/M
7000000698Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159551223Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
sp300_012235902124908012Subgingival PlaqueMSSNQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR
Ga0099374_1000028883300006247HumanMTNNKQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR*
Ga0099387_1000031003300006248HumanMTNNKQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK*
Ga0099392_10269133300006251HumanMNKQQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK*
Ga0099365_1000039603300006254HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELINYTDKNKVQK*
Ga0099458_100116753300006259HumanMNKETEHELAELHEKERGLEKALELVREKIRELVNYTDKNKGQK*
Ga0099521_1000011493300006261HumanMESLLRLRVVNNKQTEHELSELYEKERSLEKALELVREKIRELINYTNKNKAAR*
Ga0099622_10031833300006292HumanMSKEQAEHELAELYEPERSLEKALERVRERIRETINYTNKNKAAR*
Ga0099581_100219103300006319HumanMNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK*
Ga0099581_100223653300006319HumanMNKETEHELAELHEKERSLEKALELVREKIRELINYTDKNKV*
Ga0099624_100228163300006321HumanMASSLMYFIRSMRMGSLSRLKMNKEQAEHELAELHAQERSLEKALELVREKIRELVNYTDKNKEQK*
Ga0099694_100664123300006348HumanMTNNKQAEHELAELHEKERSLEKALELVRERIRELVNYTDKNKEQK*
Ga0100214_100163373300006457HumanMTNNKQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKSAR*
Ga0100061_100098123300006460HumanMKKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKG*
Ga0100232_11787623300006477HumanMEKEHAEHELSELHEKERSLEKALEIVREKIRELVNYTDKNKVQK*
Ga0100254_10023193300006489HumanMNREQVEHELAELHEKERSLEKAIELVREKIRELVNYTDKNKG*
Ga0100058_100244213300006678HumanMNKEQTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK*
Ga0104033_100373363300007079HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV*
Ga0102538_102800123300007096HumanLGERMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYMDKNKGQK*
Ga0102700_1000240213300007125HumanMNKEQAEHELAELHEKERSLEKALEIVREKIRELINYTDKNKG*
Ga0102700_101167013300007125HumanMEKEQAEHELAELHAQERSLEKALELVREKIRELVNYTDKNKV*
Ga0102725_100081663300007128HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGRK*
Ga0102639_100004593300007135HumanMNKEQVEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR*
Ga0103259_10913553300007186HumanMESLLRLRMTNNKQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK*
Ga0103269_100346583300007194HumanMNKETEHELAELHEKERSLEKALELVREKIRELINYTDKNKG*
Ga0103275_1000031243300007204HumanMSSNQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR*
Ga0104339_10448213300007278HumanMNKEQAKHELAELHEKERSLEKALELVREKIRELVNCTDKNKV*
Ga0104867_1001063133300007295HumanMEKQQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGNNNETKF*
Ga0104843_100193103300007300HumanMNKETEHELAELHAQERSLEKALEIVREKIRELVNYTDKNKV*
Ga0104968_100220573300007314HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK*
Ga0104922_10305263300007316HumanMEKEQAEHELAELHAQERSLEKALELVREKIRELINYADKNKGQK*
Ga0104971_100081643300007339HumanMNKETEHELAELHEKERSLEKALELVREKIRELVNYTNKNKGQK*
Ga0105531_100497433300007648HumanMEKETEHELAELHEKERSLEKALELVREKIRELINYTDKNKVHK*
Ga0105757_1000081153300007736HumanMNKEQTEHELAELHEKERSLEKALELVREKIRELVNCTDKNKAAR*
Ga0105778_100652113300007753HumanMNKEHAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV*
Ga0111024_10161843300007869HumanMNKETEHELAELYAQERSLEKALELVREKIRELVNYMDKNKEQK*
Ga0114094_102941913300007971HumanMNKEQAEHELAELHEKEQSLEKALELVREKIRELVNYTDKNKEQK*
Ga0111052_101883103300007996HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKVYK*
Ga0114261_10589573300008099HumanMNKQQTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV*
Ga0114856_101058493300008125HumanMNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK*
Ga0114847_11407133300008128HumanMNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV*
Ga0111365_100238553300008133HumanMNKEQAEHELAELHAQERSLEKALELVREKIRELVNYTDKNKEQK*
Ga0111365_14570823300008133HumanKEQTEHELAELHEKEQSLEKALEIVREKIRELINYTNKNKAAR*
Ga0114843_100165623300008138HumanMEKQQAEHELAELHEKERSLEKALELVREKIRELINYTDKNKEQK*
Ga0114287_10031893300008143HumanMEKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK*
Ga0114367_10193973300008147HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTNKNKGQK*
Ga0114159_10103123300008270HumanMNNKQAEQELAELHEKERSLEKALEIVREKIRELINYTNKNKV*
Ga0114252_10284063300008274HumanMNKQQTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK*
Ga0114263_1001214103300008279HumanMNKETEHELAELHEKERSLEKALEIVREKIRELVNYTDKNKV*
Ga0115183_10007473300008305HumanMEKETEHELAELHEKERSLEKTLELVREKIRELVNYTNKNKGQK*
Ga0115302_100087273300008333HumanMNKQQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV*
Ga0115302_101121183300008333HumanMNKQQAEHELAELHEKERSLEKALELVREKIRELINYTDKNKGNNNGAKF*
Ga0115182_100602193300008403HumanMNKEQAEHELAELHEKERSLEKALELVRERIRETINYTNKNKAAR*
Ga0115418_100271563300008436HumanMNKEQLEHELAELHEKEQSLEKALELVREKIRELVNYTDKNKV*
Ga0115373_102778823300008472HumanMNKEAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR*
Ga0115191_100217503300008518HumanMEKEQAEHELAELHAQERSLEKALELVREKIRELINYTNKNKAAR*
Ga0111059_10296933300008556HumanMNKEQAEHELAELHEKERSLEKALEIVREKIRELVNYTDKNKEQK*
Ga0111364_100202553300008626HumanMNKETEHELAELHEKERGLEKALELVREKIRELVNYTDKNKV*
Ga0111492_102844133300008660HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYMDKNKGQK*
Ga0113984_10331173300008732HumanMGKEQLERELAGLHEKERSLEKALELVREKIRELVNYTDKNKG*
Ga0114021_13555433300008739HumanMNKEQAEHELAELHAQERSLEKALEIVREKIRELVNYTDKNKGQK*
Ga0133740_10010353300009954Human Oral CavityMNKEHVEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV*
Ga0133745_1016553300009961Human Oral CavityMEKEQAKHELAELHEKERSLEKALELVREKIRELINYTDKNKEQK*
Ga0119781_11690633300011967Human OralMTNNKQAEHELAELHGKERSLEKALELVREKIRELINYTNKNKAAR*
Ga0119773_100613263300011982Human OralMEKEHAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV*
Ga0134359_100799343300014108Human OralMNNKQAEQELAELHEKERSLEKALEIVREKIRELINYTDKNKEQK*
Ga0169829_100265823300014951Human Host-AssociatedMNKEQAEHELAELHEQERSLEKALELVREKIRELVNYTDKNKVQK*
Ga0244137_100259563300029479Human FecalMNKEHAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV
Ga0243220_10344463300029679Human FecalMNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK
SRS022536_LANL_scaffold_112765__gene_2483237000000005HumanMSKEQAEHELAELYEPERSLEKALERVRERIRETINYTNKNKAAR
SRS018300_Baylor_scaffold_43448__gene_607197000000009HumanMNKEQAEHELAELHAQERSLEKALELVREKIRELVNYTDKNKEQK
SRS023538_Baylor_scaffold_41056__gene_634047000000016HumanMTNNKQAEHELAELHEKERSLEKALELVRERIRELVNYTDKNKEQK
SRS023617_Baylor_scaffold_29664__gene_396587000000025HumanMNKEQTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK
C2568910__gene_1520097000000027HumanMKKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKG
SRS042131_WUGC_scaffold_53336__gene_890727000000029HumanMNKETEHELAELHEKERSLEKALELVREKIRELINYTDKNKV
SRS019333_WUGC_scaffold_16267__gene_164897000000033HumanMTNNKQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKSAR
C2361491__gene_1442947000000039HumanMNKQQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK
C3788548__gene_1368087000000042HumanMEKEHAEHELSELHEKERSLEKALEIVREKIRELVNYTDKNKVQK
C1816283__gene_265427000000051HumanMNREQVEHELAELHEKERSLEKAIELVREKIRELVNYTDKNKG
C4112281__gene_1333727000000086HumanMNKETEHELAELHEKERSLEKALELVREKIRELVNYTNKNKGQK
C3289035__gene_1272357000000099HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYMDKNKGQK
SRS011098_Baylor_scaffold_27433__gene_349297000000110HumanMNKEQVEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR
SRS050244_LANL_scaffold_36247__gene_424157000000128HumanMEKEQAEHELAELHAQERSLEKALELVREKIRELVNYTDKNKV
SRS012285_Baylor_scaffold_55315__gene_706317000000132HumanMTNNKQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR
SRS044373_WUGC_scaffold_60621__gene_825747000000140HumanMNKETEHELAELHEKERSLEKALELVREKIRELINYTDKNKG
C4869098__gene_2213387000000144HumanMTNNKQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK
SRS063288_LANL_scaffold_63181__gene_1098417000000159HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV
SRS017013_Baylor_scaffold_23037__gene_273307000000180HumanMNKEQAKHELAELHEKERSLEKALELVREKIRELVNCTDKNKV
SRS017013_Baylor_scaffold_23698__gene_289227000000180HumanMEKEQAEHELAELHEQERSLEKALELVREKIRELVNYTNKNKG
SRS017209_Baylor_scaffold_24281__gene_311827000000195HumanMEKQQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGNNNETKF
SRS017808_Baylor_scaffold_3102__gene_31317000000197HumanMNKETEHELAELHAQERSLEKALEIVREKIRELVNYTDKNKV
SRS024441_LANL_scaffold_56521__gene_777957000000203HumanMEKEQAEHELAELHAQERSLEKALELVREKIRELINYADKNKGQK
SRS057539_LANL_scaffold_23351__gene_294527000000222HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK
SRS054687_LANL_scaffold_48704__gene_443417000000276HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELINYTDKNKVQK
SRS019219_WUGC_scaffold_66328__gene_1012387000000295HumanMNKETEHELAELHEKERGLEKALELVREKIRELVNYTDKNKGQK
SRS016092_WUGC_scaffold_6431__gene_84167000000301HumanVNNKQTEHELSELYEKERSLEKALELVREKIRELINYTNKNKAAR
SRS058053_LANL_scaffold_56837__gene_580247000000313HumanMNKEQTEHELAELHEKERSLEKALELVREKIRELVNCTDKNKAAR
SRS019607_WUGC_scaffold_57356__gene_809817000000394HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKVYK
SRS024580_LANL_scaffold_42492__gene_514157000000402HumanMNKEQAEHELAELHEKERSLEKALEIVREKIRELVNYTDKNKEQK
SRS015644_WUGC_scaffold_3027__gene_43617000000436HumanMNKETEHELAELHEKERGLEKALELVREKIRELVNYTDKNKV
C3994762__gene_1805817000000457HumanMEKETEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR
SRS016529_Baylor_scaffold_4770__gene_49867000000488HumanMEKETEHELAELHEKERSLEKTLELVREKIRELVNYTNKNKGQK
C2689454__gene_801507000000504HumanMGKEQLERELAGLHEKERSLEKALELVREKIRELVNYTDKNKG
C2450981__gene_1646897000000513HumanMNKEQAEHELAELHAQERSLEKALEIVREKIRELVNYTDKNKGQK
SRS018357_Baylor_scaffold_41345__gene_426817000000519HumanMNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNK
SRS019126_WUGC_scaffold_42151__gene_651137000000523HumanMNKEQAEHELAELHEKEQSLEKALELVREKIRELVNYTDKNKEQK
C1180083__gene_341567000000537HumanMNNKQAEQELAELHEKERSLEKALEIVREKIRELINYTNKNKV
C2408155__gene_1060037000000553HumanMNKQQTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK
SRS057355_LANL_scaffold_33617__gene_266367000000561HumanHELAELHEKERSLEKALELVREKIRELVNYTDKNKRG
SRS057355_LANL_scaffold_40971__gene_355297000000561HumanHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK
C2625508__gene_1100557000000563HumanMNKQQTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV
C4123271__gene_1967457000000576HumanMEKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK
C2620538__gene_1108367000000599HumanMNKEQAEHELAELHEKERSLEKALELVREKIRELVNYTNKNKGQK
SRS019894_WUGC_scaffold_9248__gene_88277000000604HumanMEKQQAEHELAELHEKERSLEKALELVREKIRELINYTDKNKEQK
C3029880__gene_2138617000000618HumanMNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK
C1354017__gene_755207000000656HumanMNKEQAEHELAELHEKERSLEKALELVRERIRETINYTNKNKAAR
SRS018969_WUGC_scaffold_56897__gene_459167000000658HumanTEHELAELHEKERSLEKALELVREKIRELVNYTDKNKGQK
SRS016037_WUGC_scaffold_40989__gene_657527000000665HumanQAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK
SRS016037_WUGC_scaffold_43873__gene_740847000000665HumanQAEHELAELHAQERSLEKALELVREKIRELINYTNKNKAAR
C3750397__gene_1844517000000698HumanMNKEAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.