NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007278

3300007278: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160319967 reassembly



Overview

Basic Information
IMG/M Taxon OID3300007278 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052682 | Ga0104339
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 160319967 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size28502277
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2791
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045567Metagenome152N
F055792Metagenome138N
F073671Metagenome120N
F077781Metagenome / Metatranscriptome117N
F094006Metagenome106Y
F098763Metagenome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0104339_100934All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2792524Open in IMG/M
Ga0104339_101582All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1663Open in IMG/M
Ga0104339_103119Not Available1045Open in IMG/M
Ga0104339_104482All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae847Open in IMG/M
Ga0104339_107738All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan632Open in IMG/M
Ga0104339_108895All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae586Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0104339_100934Ga0104339_1009343F045567MRQRDGRDTLTEELEGGIIPLLYRAEGEARRPWVRMVTEDVVHTSTHRVKDALLPVDGDILTPRDGTHIVQTERVVVVLVSQEDSIDTIDTETCGLVVEVRATVDEDTLPTLGDDEGRGAQTTVTSIRAMAHRAATAYLGDTSAGARTEKNYLHVSRRESYHG*
Ga0104339_101582Ga0104339_1015822F098763MDRRTSLRILSTALYLATKLFEAVVRATISYDPSDEVEGKGGMNAIPTAVDE*
Ga0104339_103119Ga0104339_1031192F055792VEIASEALDSTSAVTHRILFLTTQLGESLLTSLGTEDGVIAEAMVTRALESNLSIDSTLEEVGPVLIDKGDDGTEASTTWGRYTLETLQKEGYILFEGSMLPCEARRVDSRSSVKSLNLEPRIIGEAIEPVALPDVTRLDESIALQGIGSLRDLLMTPDVSETDHLQTSREEGTDLLQLMGIIARKYQLFHTFVS*
Ga0104339_104482Ga0104339_1044821F073671MNKEQAKHELAELHEKERSLEKALELVREKIRELVNCTDKNKV*
Ga0104339_107738Ga0104339_1077381F077781PPPIAAPARPAPAHLKAPAAVTGGWGSPRQNDFFILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRTADSLCLGFPRPHPGTPGLGRFWPFLALQSLSETPSHARMPRVTVARTSPETLEISPLRAAT*
Ga0104339_108895Ga0104339_1088951F094006LEPADPTGTLYESAVCVEAHIGELQAGGIARRGLFAFGRRDLLAVAELGAEAPYAIDMYDIAVCEPLSELFAKELEYAFNFGA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.