| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029679 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133112 | Gp0282357 | Ga0243220 |
| Sample Name | Human fecal microbial communities from healthy subjects in Hangzhou, China - HD-50_Run5 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Zhejiang University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 129820388 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis | 1 |
| All Organisms → Viruses → Predicted Viral | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Hangzhou | |||||||
| Coordinates | Lat. (o) | 30.0 | Long. (o) | 120.0 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054110 | Metagenome | 140 | N |
| F073671 | Metagenome | 120 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0243220_100371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis | 43124 | Open in IMG/M |
| Ga0243220_103314 | All Organisms → Viruses → Predicted Viral | 4861 | Open in IMG/M |
| Ga0243220_103444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 4703 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0243220_100371 | Ga0243220_10037123 | F054110 | VNYQPTIKKLLKALQVNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVKAYKGGD |
| Ga0243220_103314 | Ga0243220_1033143 | F054110 | VVLDVNYQPTIRKLLTALRMNGRRYVVDTRQSWSKYDKPCKIYIVSRMYTEEEYKLTFPEKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVRTYKGGE |
| Ga0243220_103444 | Ga0243220_1034446 | F073671 | MNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK |
| ⦗Top⦘ |