NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029679

3300029679: Human fecal microbial communities from healthy subjects in Hangzhou, China - HD-50_Run5



Overview

Basic Information
IMG/M Taxon OID3300029679 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133112 | Gp0282357 | Ga0243220
Sample NameHuman fecal microbial communities from healthy subjects in Hangzhou, China - HD-50_Run5
Sequencing StatusPermanent Draft
Sequencing CenterZhejiang University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size129820388
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis1
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationChina: Hangzhou
CoordinatesLat. (o)30.0Long. (o)120.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054110Metagenome140N
F073671Metagenome120N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0243220_100371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis43124Open in IMG/M
Ga0243220_103314All Organisms → Viruses → Predicted Viral4861Open in IMG/M
Ga0243220_103444All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus4703Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0243220_100371Ga0243220_10037123F054110VNYQPTIKKLLKALQVNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVKAYKGGD
Ga0243220_103314Ga0243220_1033143F054110VVLDVNYQPTIRKLLTALRMNGRRYVVDTRQSWSKYDKPCKIYIVSRMYTEEEYKLTFPEKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVRTYKGGE
Ga0243220_103444Ga0243220_1034446F073671MNKETEHELAELHEKERSLEKALELVREKIRELVNYTDKNKEQK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.