NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006489

3300006489: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764487809



Overview

Basic Information
IMG/M Taxon OID3300006489 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052516 | Ga0100254
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 2, subject 764487809
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size29109650
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067846Metagenome125Y
F073671Metagenome120N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0100254_100231All Organisms → Viruses8135Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0100254_100231Ga0100254_10023115F067846MESLQAQWERKTFNDHDRRCCAEDAYNEAVEREIECIEEDISNGDSDAICAFSEKMFDDDEFLKAVALGTDCEEMRIKILTAMAEDRLEQLEEDYKNGYILNN*
Ga0100254_100231Ga0100254_1002319F073671MNREQVEHELAELHEKERSLEKAIELVREKIRELVNYTDKNKG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.