Basic Information | |
---|---|
IMG/M Taxon OID | 7000000656 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053232 | Ga0031123 |
Sample Name | Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764042746 |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 43776434 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales | 1 |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Verophasmatodea → Areolatae → Bacilloidea → Bacillidae → Bacillinae → Bacillini → Bacillus | 1 |
All Organisms → Viruses → Predicted Viral | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | National Institutes of Health, USA | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036281 | Metagenome | 170 | N |
F054109 | Metagenome | 140 | N |
F073671 | Metagenome | 120 | N |
F085821 | Metagenome | 111 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
C1341820 | Not Available | 770 | Open in IMG/M |
C1354017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales | 1135 | Open in IMG/M |
SRS065310_LANL_scaffold_17602 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Verophasmatodea → Areolatae → Bacilloidea → Bacillidae → Bacillinae → Bacillini → Bacillus | 26996 | Open in IMG/M |
SRS065310_LANL_scaffold_6840 | All Organisms → Viruses → Predicted Viral | 1806 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
C1341820 | C1341820__gene_68379 | F085821 | MNHIFEQLAPLAETKKQQTTVAKFIEKGFKFTRQPDVQKFKLLTADFFVAGNMPAVQLCLDYLVAQGYPTAENEKQFLNWVFMEPIYYLKYFISDTSTQKKLHHDLLNLWYECSKRQLLEQDKGKHDEAYIDTWNEANVNKTLSIIRSGETIASRKEDVAKHSKTLNDEYDQNVNLLYEYCRALLYTAETTQSQQELVAETQSHIALLKDLYKKVNKIK |
C1354017 | C1354017__gene_75520 | F073671 | MNKEQAEHELAELHEKERSLEKALELVRERIRETINYTNKNKAAR |
SRS065310_LANL_scaffold_17602 | SRS065310_LANL_scaffold_17602__gene_19971 | F054109 | MFKEKTYMTGRPKSKKGVKVHTAFKIYPKDKERAQIMADKLDMSLSAYINKAVLEKLAHDEKSEASTETN |
SRS065310_LANL_scaffold_6840 | SRS065310_LANL_scaffold_6840__gene_4536 | F036281 | MITLIKVDEGPVDIYELRMQYLAKLKQTDGVMLPTFIYRNKDLFVTEFKPTCDDQWIMYMTNAEGLITKMRIKNGDLMSNGSVLFLAEEQKTYNAKEYYDYWTAREGKPAPFFYESRQYHVKSFMRVPGSTDLWITAERETGHWYTFRMSDDQKSKFTRHTMTNEKGHQSYDWVLENVEWAA |
⦗Top⦘ |