Basic Information | |
---|---|
IMG/M Taxon OID | 3300009954 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120337 | Gp0151212 | Ga0133740 |
Sample Name | Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 6 |
Sequencing Status | Permanent Draft |
Sequencing Center | Autonomous University of Barcelona |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 5865750 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 4 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Saliva Viral Communities From Oral Cavities Of Healthy Adults From Alicante,Spain |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral Cavity → Human Saliva Viral Communities From Oral Cavities Of Healthy Adults From Alicante,Spain |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Alicante,Spain | |||||||
Coordinates | Lat. (o) | 38.3852246 | Long. (o) | -0.5132249 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054110 | Metagenome | 140 | N |
F067846 | Metagenome | 125 | Y |
F073671 | Metagenome | 120 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0133740_10010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 33459 | Open in IMG/M |
Ga0133740_10012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis | 29827 | Open in IMG/M |
Ga0133740_10016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis | 23924 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0133740_10010 | Ga0133740_1001035 | F073671 | MNKEHVEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV* |
Ga0133740_10010 | Ga0133740_1001041 | F067846 | MSIIAEWERQEFNKWDKQCSKEDDYNRAVEMEIESIKEDIANGDDDAMCAFSEKMFDDDEFLKAIALGTDCEEMRIKILTAMAEDRLEQLEKDYKNGYILND* |
Ga0133740_10012 | Ga0133740_1001221 | F054110 | VNYQPTIKKLLKALQMNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKPKQLYKKESEYSSTKQHEVLLFLVRTYKGGE* |
Ga0133740_10016 | Ga0133740_100163 | F054110 | VNYQPTIKKLLKALQMNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVRTYKGGD* |
⦗Top⦘ |