| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009954 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120337 | Gp0151212 | Ga0133740 |
| Sample Name | Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 6 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Autonomous University of Barcelona |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 5865750 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 4 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Saliva Viral Communities From Oral Cavities Of Healthy Adults From Alicante,Spain |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral Cavity → Human Saliva Viral Communities From Oral Cavities Of Healthy Adults From Alicante,Spain |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Alicante,Spain | |||||||
| Coordinates | Lat. (o) | 38.3852246 | Long. (o) | -0.5132249 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054110 | Metagenome | 140 | N |
| F067846 | Metagenome | 125 | Y |
| F073671 | Metagenome | 120 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0133740_10010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 33459 | Open in IMG/M |
| Ga0133740_10012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis | 29827 | Open in IMG/M |
| Ga0133740_10016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis | 23924 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0133740_10010 | Ga0133740_1001035 | F073671 | MNKEHVEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV* |
| Ga0133740_10010 | Ga0133740_1001041 | F067846 | MSIIAEWERQEFNKWDKQCSKEDDYNRAVEMEIESIKEDIANGDDDAMCAFSEKMFDDDEFLKAIALGTDCEEMRIKILTAMAEDRLEQLEKDYKNGYILND* |
| Ga0133740_10012 | Ga0133740_1001221 | F054110 | VNYQPTIKKLLKALQMNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKPKQLYKKESEYSSTKQHEVLLFLVRTYKGGE* |
| Ga0133740_10016 | Ga0133740_100163 | F054110 | VNYQPTIKKLLKALQMNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVRTYKGGD* |
| ⦗Top⦘ |