NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F077405

Metagenome Family F077405

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077405
Family Type Metagenome
Number of Sequences 117
Average Sequence Length 46 residues
Representative Sequence QGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK
Number of Associated Samples 101
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 14.53 %
% of genes near scaffold ends (potentially truncated) 85.47 %
% of genes from short scaffolds (< 2000 bps) 65.81 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (53.846 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human
(53.846 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
(92.308 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 82.69%    β-sheet: 0.00%    Coil/Unstructured: 17.31%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF01066CDP-OH_P_transf 58.12
PF104171-cysPrx_C 9.40
PF10063DUF2301 5.13
PF01053Cys_Met_Meta_PP 5.13
PF07715Plug 3.42
PF067253D 2.56
PF08245Mur_ligase_M 2.56
PF01297ZnuA 0.85
PF01258zf-dskA_traR 0.85
PF00593TonB_dep_Rec 0.85
PF04055Radical_SAM 0.85
PF10672Methyltrans_SAM 0.85
PF00578AhpC-TSA 0.85
PF00155Aminotran_1_2 0.85
PF02518HATPase_c 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 58.12
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 58.12
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 58.12
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 5.13
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 5.13
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 5.13
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 5.13
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 5.13
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 5.13
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 5.13
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 5.13
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 5.13
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 5.13
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 5.13
COG1734RNA polymerase-binding transcription factor DksATranscription [K] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms53.85 %
UnclassifiedrootN/A46.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2044078009|mobDRAFT_NODE_731_len_4875_cov_15_924513All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae4909Open in IMG/M
3300006244|Ga0099354_100013All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae56676Open in IMG/M
3300006250|Ga0099391_103416All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae8372Open in IMG/M
3300006254|Ga0099365_1029509Not Available836Open in IMG/M
3300006255|Ga0099353_1008872All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae2677Open in IMG/M
3300006259|Ga0099458_100882All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae20713Open in IMG/M
3300006260|Ga0099518_108127All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae2854Open in IMG/M
3300006260|Ga0099518_122730Not Available846Open in IMG/M
3300006260|Ga0099518_126328Not Available707Open in IMG/M
3300006289|Ga0099614_122222Not Available888Open in IMG/M
3300006289|Ga0099614_122250Not Available887Open in IMG/M
3300006301|Ga0099617_105495All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus2282Open in IMG/M
3300006321|Ga0099624_123333Not Available881Open in IMG/M
3300006458|Ga0100175_120656Not Available863Open in IMG/M
3300006458|Ga0100175_120921Not Available851Open in IMG/M
3300006462|Ga0100062_109237All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae2408Open in IMG/M
3300006475|Ga0100234_101021All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae2170Open in IMG/M
3300006477|Ga0100232_118339All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1211Open in IMG/M
3300006488|Ga0100250_125123Not Available667Open in IMG/M
3300006496|Ga0100375_1006984All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1572Open in IMG/M
3300006521|Ga0101032_100869All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus2720Open in IMG/M
3300006545|Ga0101078_100377All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae8409Open in IMG/M
3300006566|Ga0100365_1001772All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae13206Open in IMG/M
3300006566|Ga0100365_1049966Not Available731Open in IMG/M
3300006678|Ga0100058_104719All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae4989Open in IMG/M
3300006678|Ga0100058_120092Not Available866Open in IMG/M
3300006742|Ga0101805_113232Not Available861Open in IMG/M
3300006832|Ga0099611_125437Not Available821Open in IMG/M
3300006898|Ga0102522_100546All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae4913Open in IMG/M
3300007079|Ga0104033_130275Not Available595Open in IMG/M
3300007087|Ga0102673_105719Not Available770Open in IMG/M
3300007096|Ga0102538_123288Not Available814Open in IMG/M
3300007124|Ga0102685_121000All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1213Open in IMG/M
3300007196|Ga0103270_103510All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae4999Open in IMG/M
3300007208|Ga0103291_130005Not Available628Open in IMG/M
3300007208|Ga0103291_130994Not Available606Open in IMG/M
3300007285|Ga0102636_108218Not Available746Open in IMG/M
3300007287|Ga0104873_116780Not Available865Open in IMG/M
3300007295|Ga0104867_1020754All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus1594Open in IMG/M
3300007300|Ga0104843_105285All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae4715Open in IMG/M
3300007309|Ga0104928_100221All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae10338Open in IMG/M
3300007314|Ga0104968_105070All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae5090Open in IMG/M
3300007335|Ga0104969_1002734All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae8375Open in IMG/M
3300007358|Ga0104765_119714All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1239Open in IMG/M
3300007531|Ga0105502_1039992Not Available871Open in IMG/M
3300007531|Ga0105502_1041043Not Available845Open in IMG/M
3300007660|Ga0105538_101805All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae2162Open in IMG/M
3300007711|Ga0105642_1030292Not Available830Open in IMG/M
3300007711|Ga0105642_1047317Not Available593Open in IMG/M
3300007711|Ga0105642_1047453Not Available592Open in IMG/M
3300007888|Ga0111236_100464All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae6496Open in IMG/M
3300007924|Ga0113552_100033All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae118020Open in IMG/M
3300007968|Ga0105969_113603All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1173Open in IMG/M
3300007978|Ga0111424_115373All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1221Open in IMG/M
3300007978|Ga0111424_115436All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1218Open in IMG/M
3300007979|Ga0114002_109769All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1944Open in IMG/M
3300007994|Ga0113878_139840Not Available598Open in IMG/M
3300008090|Ga0114309_128235Not Available873Open in IMG/M
3300008099|Ga0114261_120957Not Available868Open in IMG/M
3300008102|Ga0114249_1012311All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1924Open in IMG/M
3300008123|Ga0114854_102049All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae8411Open in IMG/M
3300008123|Ga0114854_105880All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae3380Open in IMG/M
3300008130|Ga0114850_100133All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae78827Open in IMG/M
3300008135|Ga0111463_1030602Not Available783Open in IMG/M
3300008139|Ga0114845_1016903All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1857Open in IMG/M
3300008275|Ga0114253_1008449All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae3387Open in IMG/M
3300008276|Ga0114259_1001463All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae8404Open in IMG/M
3300008276|Ga0114259_1037959Not Available598Open in IMG/M
3300008278|Ga0114262_110776All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus2184Open in IMG/M
3300008278|Ga0114262_132065Not Available752Open in IMG/M
3300008333|Ga0115302_105299All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae4240Open in IMG/M
3300008406|Ga0115224_1045883Not Available609Open in IMG/M
3300008406|Ga0115224_1050183Not Available551Open in IMG/M
3300008420|Ga0115228_149907Not Available527Open in IMG/M
3300008472|Ga0115373_1033523Not Available831Open in IMG/M
3300008503|Ga0111013_128157Not Available857Open in IMG/M
3300008506|Ga0115176_1000259All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae50755Open in IMG/M
3300008521|Ga0115192_117525Not Available882Open in IMG/M
3300008522|Ga0111045_115509All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1591Open in IMG/M
3300008524|Ga0111046_121964Not Available881Open in IMG/M
3300008537|Ga0111051_112049All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae2118Open in IMG/M
3300008581|Ga0111080_128484Not Available868Open in IMG/M
3300008628|Ga0111366_115551Not Available835Open in IMG/M
3300008734|Ga0113998_120942All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1246Open in IMG/M
3300008739|Ga0114021_100467All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae32503Open in IMG/M
3300008742|Ga0115672_122880All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1199Open in IMG/M
3300008747|Ga0115677_111611All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1223Open in IMG/M
3300008748|Ga0114085_125103Not Available871Open in IMG/M
3300008756|Ga0114092_115208Not Available817Open in IMG/M
3300014137|Ga0134350_1020957Not Available859Open in IMG/M
3300014140|Ga0134344_1003466All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae3567Open in IMG/M
3300014290|Ga0134363_104414All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1679Open in IMG/M
3300014947|Ga0169813_104260All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae3957Open in IMG/M
3300014947|Ga0169813_118040Not Available793Open in IMG/M
3300029218|Ga0168718_100244All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae80555Open in IMG/M
3300029548|Ga0245003_135212Not Available551Open in IMG/M
3300029820|Ga0245026_128125All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1373Open in IMG/M
7000000018|SRS022725_LANL_scaffold_44666All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae2771Open in IMG/M
7000000033|SRS019333_WUGC_scaffold_22095All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae8948Open in IMG/M
7000000048|SRS055401_LANL_scaffold_33675Not Available642Open in IMG/M
7000000072|SRS016503_LANL_scaffold_6143Not Available796Open in IMG/M
7000000076|C808129All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae997Open in IMG/M
7000000095|SRS018975_WUGC_scaffold_38758All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae1582Open in IMG/M
7000000097|C1015461Not Available584Open in IMG/M
7000000146|C1485913Not Available598Open in IMG/M
7000000164|SRS015374_WUGC_scaffold_7377All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus influenzae10351Open in IMG/M
7000000208|SRS011126_Baylor_scaffold_17227Not Available538Open in IMG/M
7000000267|C1208720Not Available867Open in IMG/M
7000000331|SRS013836_Baylor_scaffold_28699All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae1128Open in IMG/M
7000000364|SRS051941_LANL_scaffold_6640Not Available807Open in IMG/M
7000000430|SRS015799_WUGC_scaffold_1220All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae1053Open in IMG/M
7000000480|SRS015209_WUGC_scaffold_21572All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae1529Open in IMG/M
7000000511|SRS018591_WUGC_scaffold_44471All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae2594Open in IMG/M
7000000526|C1405470Not Available707Open in IMG/M
7000000568|SRS051930_LANL_scaffold_2527Not Available709Open in IMG/M
7000000651|SRS063932_LANL_scaffold_99588All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae2248Open in IMG/M
7000000681|SRS018439_Baylor_scaffold_10999All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae1123Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
HumanHost-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human53.85%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human17.95%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human12.82%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Saliva → Human2.56%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral2.56%
Human FecalHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal1.71%
Human Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated1.71%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human1.71%
HumanHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human0.85%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.85%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human0.85%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Palatine Tonsils → Human0.85%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral0.85%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Attached/Keratinized Gingiva → Human0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2044078009Sample 10347Host-AssociatedOpen in IMG/M
3300006244Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764811490Host-AssociatedOpen in IMG/M
3300006250Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159510762Host-AssociatedOpen in IMG/M
3300006254Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 706846339Host-AssociatedOpen in IMG/M
3300006255Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 737052003Host-AssociatedOpen in IMG/M
3300006259Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765034022Host-AssociatedOpen in IMG/M
3300006260Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159915365Host-AssociatedOpen in IMG/M
3300006289Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 809635352Host-AssociatedOpen in IMG/M
3300006301Human buccal mucosa microbial communities from NIH, USA - visit 2 of subject 764224817Host-AssociatedOpen in IMG/M
3300006321Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160380657Host-AssociatedOpen in IMG/M
3300006458Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 764487809Host-AssociatedOpen in IMG/M
3300006462Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 159207311Host-AssociatedOpen in IMG/M
3300006475Human buccal mucosa microbial communities from NIH, USA - visit 2 of subject 158883629Host-AssociatedOpen in IMG/M
3300006477Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 158883629Host-AssociatedOpen in IMG/M
3300006488Human supragingival plaque microbial communities from NIH, USA - visit number 1 of subject 675950834Host-AssociatedOpen in IMG/M
3300006496Human saliva microbial communities from NIH, USA - visit 2, subject 763577454Host-AssociatedOpen in IMG/M
3300006521Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159753524 replicate 2Host-AssociatedOpen in IMG/M
3300006545Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 823052294Host-AssociatedOpen in IMG/M
3300006566Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159268001Host-AssociatedOpen in IMG/M
3300006678Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 159005010Host-AssociatedOpen in IMG/M
3300006742Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160158126Host-AssociatedOpen in IMG/M
3300006832Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159571453Host-AssociatedOpen in IMG/M
3300006898Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160400887Host-AssociatedOpen in IMG/M
3300007079Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 809635352Host-AssociatedOpen in IMG/M
3300007087Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 158944319Host-AssociatedOpen in IMG/M
3300007096Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 604812005Host-AssociatedOpen in IMG/M
3300007124Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159268001Host-AssociatedOpen in IMG/M
3300007196Human saliva microbial communities from NIH, USA - visit 1, subject 763961826Host-AssociatedOpen in IMG/M
3300007208Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763901136 replicate 1Host-AssociatedOpen in IMG/M
3300007285Human attached/keratinized gingiva microbial communities from NIH, USA - visit 1, subject 763496533Host-AssociatedOpen in IMG/M
3300007287Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 158742018 reassemblyHost-AssociatedOpen in IMG/M
3300007295Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159814214 reassemblyHost-AssociatedOpen in IMG/M
3300007300Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160603188 reassemblyHost-AssociatedOpen in IMG/M
3300007309Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159247771 reassemblyHost-AssociatedOpen in IMG/M
3300007314Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 861967750 reassemblyHost-AssociatedOpen in IMG/M
3300007335Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763759525 reassemblyHost-AssociatedOpen in IMG/M
3300007358Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159551223 reassemblyHost-AssociatedOpen in IMG/M
3300007531Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764224817 reassemblyHost-AssociatedOpen in IMG/M
3300007660Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159915365 reassemblyHost-AssociatedOpen in IMG/M
3300007711Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160502038 reassemblyHost-AssociatedOpen in IMG/M
3300007888Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764487809 reassemblyHost-AssociatedOpen in IMG/M
3300007924Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764143897 reassemblyHost-AssociatedOpen in IMG/M
3300007968Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764447348 reassemblyHost-AssociatedOpen in IMG/M
3300007978Human throat microbial communities from NIH, USA - visit 1, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300007979Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765094712 reassemblyHost-AssociatedOpen in IMG/M
3300007994Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 160158126 reassemblyHost-AssociatedOpen in IMG/M
3300008090Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160643649 reassemblyHost-AssociatedOpen in IMG/M
3300008099Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763820215 reassemblyHost-AssociatedOpen in IMG/M
3300008102Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 404239096 reassemblyHost-AssociatedOpen in IMG/M
3300008123Human supragingival plaque microbial communities from NIH, USA - visit number 3 of subject 159510762 reassemblyHost-AssociatedOpen in IMG/M
3300008130Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159814214 reassemblyHost-AssociatedOpen in IMG/M
3300008135Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764224817 reassemblyHost-AssociatedOpen in IMG/M
3300008139Human subgingival plaque microbial communities from NIH, USA - visit 2, subject 763961826 reassemblyHost-AssociatedOpen in IMG/M
3300008275Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764447348 reassemblyHost-AssociatedOpen in IMG/M
3300008276Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763860675 reassemblyHost-AssociatedOpen in IMG/M
3300008278Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764649650 reassemblyHost-AssociatedOpen in IMG/M
3300008333Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 508703490 reassemblyHost-AssociatedOpen in IMG/M
3300008406Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765701615 reassemblyHost-AssociatedOpen in IMG/M
3300008420Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160218816 reassemblyHost-AssociatedOpen in IMG/M
3300008472Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159551223 reassemblyHost-AssociatedOpen in IMG/M
3300008503Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159632143 reassemblyHost-AssociatedOpen in IMG/M
3300008506Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 159510762 reassemblyHost-AssociatedOpen in IMG/M
3300008521Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 370425937 reassemblyHost-AssociatedOpen in IMG/M
3300008522Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765135172 reassemblyHost-AssociatedOpen in IMG/M
3300008524Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160319967 reassemblyHost-AssociatedOpen in IMG/M
3300008537Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765337473 reassemblyHost-AssociatedOpen in IMG/M
3300008581Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158944319 reassemblyHost-AssociatedOpen in IMG/M
3300008628Human palatine tonsils microbial communities from NIH, USA - visit 1, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300008734Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765013792 reassemblyHost-AssociatedOpen in IMG/M
3300008739Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 737052003 reassemblyHost-AssociatedOpen in IMG/M
3300008742Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159814214 reassemblyHost-AssociatedOpen in IMG/M
3300008747Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763982056 reassemblyHost-AssociatedOpen in IMG/M
3300008748Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160178356 reassemblyHost-AssociatedOpen in IMG/M
3300008756Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300014137Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_208Host-AssociatedOpen in IMG/M
3300014140Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_104Host-AssociatedOpen in IMG/M
3300014290Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_080Host-AssociatedOpen in IMG/M
3300014947Human fecal microbial communities from infant at 12 months in Denmark - 589_12MHost-AssociatedOpen in IMG/M
3300029218Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI012062-30Host-AssociatedOpen in IMG/M
3300029548Human fecal microbial communities from Shanghai, China - P092V1Host-AssociatedOpen in IMG/M
3300029820Human fecal microbial communities from Shanghai, China - P104V6Host-AssociatedOpen in IMG/M
7000000018Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 370425937Host-AssociatedOpen in IMG/M
7000000033Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765337473Host-AssociatedOpen in IMG/M
7000000048Human supragingival plaque microbial communities from NIH, USA - visit number 1 of subject 675950834Host-AssociatedOpen in IMG/M
7000000072Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159753524 replicate 2Host-AssociatedOpen in IMG/M
7000000076Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 823052294Host-AssociatedOpen in IMG/M
7000000095Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764305738Host-AssociatedOpen in IMG/M
7000000097Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160400887Host-AssociatedOpen in IMG/M
7000000146Human saliva microbial communities from NIH, USA - visit 1, subject 763961826Host-AssociatedOpen in IMG/M
7000000164Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764042746Host-AssociatedOpen in IMG/M
7000000208Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158479027Host-AssociatedOpen in IMG/M
7000000267Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159611913Host-AssociatedOpen in IMG/M
7000000331Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159571453Host-AssociatedOpen in IMG/M
7000000364Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 706846339Host-AssociatedOpen in IMG/M
7000000430Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 763435843Host-AssociatedOpen in IMG/M
7000000480Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764143897Host-AssociatedOpen in IMG/M
7000000511Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765094712Host-AssociatedOpen in IMG/M
7000000526Human stool microbial communities from NIH, USA - visit 1, subject 765560005Host-AssociatedOpen in IMG/M
7000000568Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764143897Host-AssociatedOpen in IMG/M
7000000651Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 159510762Host-AssociatedOpen in IMG/M
7000000681Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160218816Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
mobDRAFT_1162602044078009Human OralQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK
Ga0099354_10001313300006244HumanLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQK*
Ga0099391_10341613300006250HumanPRPWQGRALPTELFPRLLVAKQRGVFYGFIVLCQIKFVKNFFDWLKIIQK*
Ga0099365_102950913300006254HumanPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK*
Ga0099353_100887253300006255HumanGHGAPTPRPRPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK*
Ga0099458_10088213300006259HumanLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0099518_10812713300006260HumanQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIVQKQKVRLK*
Ga0099518_12273013300006260HumanTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIIQK*
Ga0099518_12632823300006260HumanQGRALPTELFPRLLVAKQRGVFYGFIVLCQIKFVKIFFDWLKIIQK*
Ga0099614_12222213300006289HumanQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFNWLKIIQK*
Ga0099614_12225023300006289HumanQGRALPTELFPRLLVAKQRGVFYGFIVLCQIKFVKNFFDWLKIIQK*
Ga0099617_10549553300006301HumanAGTDRGARPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK*
Ga0099624_12333323300006321HumanWQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFNWLKIIQK*
Ga0100175_12065613300006458HumanQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK*
Ga0100175_12092113300006458HumanPWQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIIQKQKVRLK*
Ga0100062_10923713300006462HumanFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK*
Ga0100234_10102143300006475HumanSNSRPRPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQK*
Ga0100232_11833913300006477HumanRPRPWQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIVQKQKARLK*
Ga0100250_12512323300006488HumanWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQK*
Ga0100375_100698433300006496HumanSNSRPRPWQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIIQKQKVRLK
Ga0101032_10086953300006521HumanSNSRPRPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK
Ga0101078_100377103300006545HumanWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK*
Ga0100365_1001772143300006566HumanLPTELFPRLLVAKQRGVFYGFISWCQIKFVKKFFD*
Ga0100365_104996623300006566HumanQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0100058_10471913300006678HumanRPWQGRALPTELFPHLLVAKQRGVFYGFILLCQIKFVKKFLIG*
Ga0100058_12009213300006678HumanWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0101805_11323223300006742HumanGRALPTELFPRLLVAKQRGVFYGFIVLCQIKFVKIFFDWLKIIQK*
Ga0099611_12543713300006832HumanPRPWQGRALPTELFPRLLVAKQRGVFYGFIVLCQIKFVKKVFDWLKIIQK*
Ga0102522_10054613300006898HumanSNSRPRPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK
Ga0104033_13027523300007079HumanQGRALPTELFPRLLVAKQRGVFYGFIVLCQIKFVKNFFDWLKIVQK*
Ga0102673_10571913300007087HumanPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQK*
Ga0102538_12328823300007096HumanQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIVQK*
Ga0102685_12100013300007124HumanGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIIQKQKVRLK*
Ga0103270_10351013300007196HumanNSRPRPWQGRALPTELFPHLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0103291_13000513300007208HumanPRPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0103291_13099423300007208HumanWQGRALPTELFPRLLVAKQRGVFYGFISWCQIKFVKKFFD*
Ga0102636_10821813300007285HumanQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDCLKIVQK*
Ga0104873_11678013300007287HumanQGRALPTELFPRLLVAKQRGVFYGFISWCQIKFVKKFFD*
Ga0104867_102075413300007295HumanLPTELFPRLLVTKQRGVFYGFISLCQIKFVKKVFDWLKIIQK*
Ga0104843_10528513300007300HumanRPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK*
Ga0104928_10022113300007309HumanQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKIFDWLKIIQKQKVRLK*
Ga0104968_10507023300007314HumanLLVTKQRGVFYGFISLCQIKFVKKVFDWLKIIQK*
Ga0104969_100273473300007335HumanLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK*
Ga0104765_11971433300007358HumanATTSRPRPWQGRALPTELFPHLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0105502_103999213300007531HumanPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK*
Ga0105502_104104313300007531HumanFPRLLVAKQRGVFYGFIVLCQIKFVKKFFDWLKIIQK*
Ga0105538_10180543300007660HumanLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIIQK*
Ga0105642_103029223300007711HumanPRLLVAKQRGVFYGFILLCQIKFVKNSFDWLKIIQKQKARLK*
Ga0105642_104731723300007711HumanPRLLVAKQRGVFYGFIVLCQIKFVKNFFDWLKIIQK*
Ga0105642_104745313300007711HumanPRLLVAKQRGVFYGFILLCQIKFVKKVFNWLKIIQK*
Ga0111236_10046413300007888HumanLLVAKQRGVFYGFISLCQIKFVKKVFDCLKIVQK*
Ga0113552_1000331093300007924HumanLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQK*
Ga0105969_11360333300007968HumanQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIVQKQKARLK*
Ga0111424_11537313300007978HumanPWQGRALPTELFPRLLVAKQRGVFYGFIVLCQIKFVKIFFDWLKIIQK*
Ga0111424_11543613300007978HumanQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKSFD*
Ga0114002_10976943300007979HumanPWQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIVQKQKARLK*
Ga0113878_13984023300007994HumanLLVAKQRGVFYGFIVLCQIKFVKKFFDWLKIIQK*
Ga0114309_12823523300008090HumanLLVAKQRGVFYGFIVLCQIKFVKIFFDWLKIIQK*
Ga0114261_12095713300008099HumanWQGRALPTELFPRLLVAKQRGVFYGFIVLCQIKFVKIFFDWLKIIQK*
Ga0114249_101231113300008102HumanGRALPTELFPHLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQK*
Ga0114854_10204913300008123HumanRPWQGRALPTELFPRLLVAKQRGVFYGFIVLCQIKFVKIFFDWLKIIQK*
Ga0114854_10588013300008123HumanRPWQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIIQK*
Ga0114850_10013323300008130HumanLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIIQKQKVRLK*
Ga0111463_103060213300008135HumanGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDCLKIVQK*
Ga0114845_101690313300008139HumanWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQK*
Ga0114253_100844953300008275HumanLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIVQKQKARLK*
Ga0114259_100146393300008276HumanRPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0114259_103795913300008276HumanRPWQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFNWLKIIQK*
Ga0114262_11077613300008278HumanQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIIQK*
Ga0114262_13206523300008278HumanFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIVQKQKVRLK*
Ga0115302_10529953300008333HumanGRALPTELFPRLLVAKQRGVFYGFISWCQIKFVKKFFD*
Ga0115224_104588323300008406HumanQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQK*
Ga0115224_105018313300008406HumanWQGRALPTELFPRLLVAKQRGVFYGFIVLCQIKFVKKFFDWLKIIQK*
Ga0115228_14990713300008420HumanRPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKVFNWLKIIQK*
Ga0115373_103352313300008472HumanRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0111013_12815723300008503HumanQGRALPTELFPRLLVAKQRGVFYGFIVLCQIKFVKKVFDWLKIIQK*
Ga0115176_100025923300008506HumanLLVAKQRGVFYGFILLCQIKFVKKIFDWLKIIQKQKVRLK*
Ga0115192_11752523300008521HumanFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0111045_11550913300008522HumanCRALPTELFPRLLVVKQRGVFYGFIVLCQIKFVKNFFDWLKIVQK*
Ga0111046_12196423300008524HumanTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQK*
Ga0111051_11204923300008537HumanVVGWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK*
Ga0111080_12848413300008581HumanPWQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKSFD*
Ga0111366_11555123300008628HumanPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIIQKQKVRLK*
Ga0113998_12094233300008734HumanQGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIVQKQKAR*
Ga0114021_100467283300008739HumanLLVAKQRGVFYGFISLCQIKFVKKVFNWLKIIQK*
Ga0115672_12288013300008742HumanALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKSFD*
Ga0115677_11161133300008747HumanQGRALPTELFPHLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0114085_12510313300008748HumanPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0114092_11520813300008756HumanKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK*
Ga0134350_102095723300014137Human OralGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIVQKQKARLK*
Ga0134344_100346623300014140Human OralLLVAKQRGVFYGFILLCQIKFVKKVFNWLKIIQK*
Ga0134363_10441443300014290Human OralGRALPTELFPHLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0169813_10426013300014947Human Host-AssociatedGRALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIVQK*
Ga0169813_11804013300014947Human Host-AssociatedGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK*
Ga0168718_10024413300029218Host-AssociatedLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK
Ga0245003_13521223300029548Human FecalLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIIQKQKVRLK
Ga0245026_12812513300029820Human FecalELFPRLLVAKQRGVFYGFIVLCQIKFVKNFFDWLKIIQKQKVRLK
SRS022725_LANL_scaffold_44666__gene_1057927000000018HumanLPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKGRLK
SRS019333_WUGC_scaffold_22095__gene_241987000000033HumanLPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK
SRS055401_LANL_scaffold_33675__gene_371167000000048HumanLPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQK
SRS016503_LANL_scaffold_6143__gene_67677000000072HumanPTELFPHLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK
C808129__gene_237447000000076HumanLPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK
SRS018975_WUGC_scaffold_38758__gene_533667000000095HumanPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK
C1015461__gene_203437000000097HumanALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK
C1485913__gene_585777000000146HumanELFPHLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK
SRS015374_WUGC_scaffold_7377__gene_87447000000164HumanALPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDCLKIVQK
SRS011126_Baylor_scaffold_17227__gene_201587000000208HumanPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQK
C1208720__gene_351807000000267HumanALPTELFPRLLVAKQRGVFYGFISWCQIKFVKKFFD
SRS013836_Baylor_scaffold_28699__gene_266037000000331HumanLPTELFPRLLVAKQRGVFYGFILLCQIKFVKKIFDWLKIIQKQKVRLK
SRS051941_LANL_scaffold_6640__gene_59037000000364HumanPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK
SRS015799_WUGC_scaffold_1220__gene_12607000000430HumanLPTELFPRLLVAKQRGVFYGFISWCQIKFVKKFFD
SRS015209_WUGC_scaffold_21572__gene_430367000000480HumanALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQK
SRS018591_WUGC_scaffold_44471__gene_896177000000511HumanLPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIVQKQKARLK
C1405470__gene_1278087000000526HumanPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIIQKQKVRLK
SRS051930_LANL_scaffold_2527__gene_23687000000568HumanPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKARLK
SRS063932_LANL_scaffold_99588__gene_1434347000000651HumanPTELFPRLLVAKQRGVFYGFILLCQIKFVKKIFDWLKIIQKQKVRLK
SRS018439_Baylor_scaffold_10999__gene_130307000000681HumanPTELFPRLLVAKQRGVFYGFIVLCQIKFVKKVFDWLKIIQK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.