| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006521 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052544 | Ga0101032 |
| Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159753524 replicate 2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 22398228 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077405 | Metagenome | 117 | N |
| F097527 | Metagenome | 104 | N |
| F105149 | Metagenome / Metatranscriptome | 100 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0101032_100869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus | 2720 | Open in IMG/M |
| Ga0101032_101734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 1429 | Open in IMG/M |
| Ga0101032_104830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis | 751 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0101032_100869 | Ga0101032_1008695 | F077405 | SNSRPRPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK |
| Ga0101032_101734 | Ga0101032_1017343 | F097527 | MIYFKMEKIGNSTKTEKKKTRSENLVIITIPAAGGETARPCGER |
| Ga0101032_104830 | Ga0101032_1048301 | F105149 | MFRKMYQGCSSTKKGLRRAMREQDDELPRDAEVRACEWPSDDFMVEVGFKEEFDAYVRNADLEGFVSDKCQQYLYLTDSFVRRFKFTSSRNSHT |
| ⦗Top⦘ |