| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000511 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053064 | Ga0031276 |
| Sample Name | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765094712 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 92402649 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046431 | Metagenome | 151 | Y |
| F066860 | Metagenome | 126 | N |
| F077405 | Metagenome | 117 | N |
| F092230 | Metagenome | 107 | N |
| F103433 | Metagenome | 101 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C1234877 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 517 | Open in IMG/M |
| SRS018591_WUGC_scaffold_14416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1132 | Open in IMG/M |
| SRS018591_WUGC_scaffold_44471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 2594 | Open in IMG/M |
| SRS018591_WUGC_scaffold_45391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14520 | Open in IMG/M |
| SRS018591_WUGC_scaffold_8683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 8367 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C1234877 | C1234877__gene_120766 | F066860 | ILIDMTTKKQKLQKQQAIDTWIVIALWVSAIWFSFARGFITGIGGWVLALLAPWALIVSCICLAIISRQMKKRHASKDHLTTIVRVSFIVMSISLFICGLAMPDFSDMETFSTLSVYTNNAISFETSKTIAIISGFVVVLSLFVAVAFGIAEDRE |
| SRS018591_WUGC_scaffold_14416 | SRS018591_WUGC_scaffold_14416__gene_28183 | F092230 | AHKRMVDKLKAHFLKVLLPLFIVCVIFVAFFRQIACGSDGDYAFQISEWGAKLKNIYGTDFINKEIIVRDNAVRVDGIRCLYAVNQNEDGLSIYLLLPGGDYLTHNYVGSSFVRFSNSSEYNNMAYGEGNVEVSDSTSTGEVQNTEEKEARDKVDDAINSMRHLFASAIMVNLRVVELYKILTVCMILIAIAITIGYYSYLKPETVYGFYCKLRRKEKYPSDENLVKRIGFLVIILPPCMLFLLIV |
| SRS018591_WUGC_scaffold_44471 | SRS018591_WUGC_scaffold_44471__gene_89617 | F077405 | LPTELFPRLLVAKQRGVFYGFISLCQIKFVKKVFDWLKIVQKQKARLK |
| SRS018591_WUGC_scaffold_45391 | SRS018591_WUGC_scaffold_45391__gene_94374 | F103433 | MKEWSKNKPGVVFFFVVWFILSISFIGNFFGTGLWSGWFDGFQKDSSAIVEKTAYCKNKYDYKGPLIAADSKDYNKIMMSQDCNPSQVKPYVSQYGLQARAIAGLSPDDASKIPAYIKRASIFLAVLTAFLLALVVQKIRALFGGITASVFVVMLSFSPWIAGYARNIYWIEPMLIAPFVISFVGYQYFKKSKKLWLFYIIESVAMFLKLLNGYEYVSTIAISVLVPIIFFELIHKNVKIINLWKQAVPVFAATVVAFFGAYWVNFVSLTDYYGSSDKAASAINARASDRGISGIRSMRAYAVGNFKILRPESYNFINKIVNLDNMANNSGKTYKYIIVNVVNYLLLPAITLPVHINGMFGEFVQSILFWTILGYLIILSSRKIIGKKYSRPFLWSMNFSVIGAFCWLALMPGHALPHAHINGIIFYIPLLLFVYILIGLWADYVVKRTVKYE |
| SRS018591_WUGC_scaffold_8683 | SRS018591_WUGC_scaffold_8683__gene_17379 | F046431 | MKKISRISITIILILSIIISYGSVIISKAAESELTLTPKPETNNIHLKWTGPQNSSYKVYQKKPGSSNFETIGLTDFSNNATDEEVKVLNIYPQESNADGRLWPTLNPSDVANIAKVLPKVQVTYLDGQTETIQKSALLKVWMEGRNSKRR |
| ⦗Top⦘ |