| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014290 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121296 | Gp0151535 | Ga0134363 |
| Sample Name | Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_080 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | The George Washington University (GWU) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 48879776 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054110 | Metagenome | 140 | N |
| F077405 | Metagenome | 117 | N |
| F105378 | Metagenome | 100 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134363_100030 | Not Available | 55682 | Open in IMG/M |
| Ga0134363_100292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella | 13334 | Open in IMG/M |
| Ga0134363_104414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae | 1679 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134363_100030 | Ga0134363_1000304 | F105378 | MNVKVYVDKIKKWVQISSDEVLDVNKNLSDLKDKEAAITNLGLYEKFISKEALESGFLPDVFTPDNIITDSTHQFVTDEEKNKWNNKLNAPVPMQDHLANNQIGYDSVNSKFYIGLNNQNVLFGGSSCFDNIIVVNGFFSGNSQPTVIRNNKFNEAGQLITPVFVDVQCIEYTAGDLGEVSVSYTTDAISIYNTGSFTGSFQCLIVYPLGSVNE* |
| Ga0134363_100292 | Ga0134363_10029211 | F054110 | VNYQPTIKKLLKALQINGRRYVVDVRQSWSKYDKPCKVYIVNRMYTKEEYKLTFPHKYKKGKTFKPKQLYKKESEYSSTKQHEVLLFLVKTYKGGE* |
| Ga0134363_104414 | Ga0134363_1044144 | F077405 | GRALPTELFPHLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQKQKVRLK* |
| ⦗Top⦘ |