NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006545

3300006545: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 823052294



Overview

Basic Information
IMG/M Taxon OID3300006545 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052548 | Ga0101078
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 823052294
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size34501236
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctYBm11
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctSdk101
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027205Metagenome195N
F043991Metagenome155N
F051212Metagenome144N
F077405Metagenome117N
F081510Metagenome114N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0101078_100377All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae8409Open in IMG/M
Ga0101078_100411All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctYBm17650Open in IMG/M
Ga0101078_107739All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctSdk10788Open in IMG/M
Ga0101078_109877All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales660Open in IMG/M
Ga0101078_113213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes533Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0101078_100377Ga0101078_10037710F077405WQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK*
Ga0101078_100411Ga0101078_1004118F081510MKLPKLPNMQTIKSTAKSAMVTTKILGKKYAPFVLLGVGLVGYGYSVYAGVKSGKKLEATKAKYEAKDAAGEEYTRMEVVKDVAKDVAIPVAVATASTAAIVLGFAIQTNRLKAVSSALAIVTEEHARYRLRAKEVLDEATFKKIDAPLETKTVELDGQEVEVESIVPNEGDFYGQWFKYSSNYVSDDPDYNESYIKEAETYLVNRMMKKGVLTFGEVLDKLGFDVPRAALPFGWTDTDDFYIEWDAHEVFDDVKQEYDLQFYVRWKTPRNLYATTSFKDFVPKKTRKELN*
Ga0101078_107739Ga0101078_1077391F027205VASRLIVSADDILKAVKESEEFERKALKEAKKRDRAEGKEPRETLYPNPDLKPGREIVLDYIKNPERRRTPRCSVHLEKRTANNSYRFIVDVSQVRNRELADEIEKDLFAFMDYLLDEYDIPQRIKRSTK*
Ga0101078_109877Ga0101078_1098771F051212EKQNTEKIERIIYSQTGGDTGGKNVYLVITKDSIIYRLTEGVTDEKTIANLSLNNNNKDWEAFIDKIDLEDFEKGKPSKELIMDLPTTKIIIKTDKKEYSKTNIQNNKTWDYITKQIIDIKFSQLYNHLNLEK*
Ga0101078_113213Ga0101078_1132131F043991MSKKTPSVIDYFSLNGDVVEEANEFDGISLEDWIDKRSSIKPSWVGQYSQQMHFDLADDTEVSFYKTPNVIYADILFAGGVRTILFKCRQKKNLTRFISRVLELANLGPKHVHPDFRA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.