NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094006

Metagenome Family F094006

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094006
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 88 residues
Representative Sequence MRGALEPADPTGALYEPAVCVEAHIGELQAGGIAHRGLFAFGGSNLLAVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA
Number of Associated Samples 101
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.96 %
% of genes near scaffold ends (potentially truncated) 21.70 %
% of genes from short scaffolds (< 2000 bps) 33.96 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.057 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human
(46.226 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
(95.283 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.13%    β-sheet: 19.13%    Coil/Unstructured: 61.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF11897DUF3417 6.60
PF00343Phosphorylase 6.60
PF08245Mur_ligase_M 5.66
PF12627PolyA_pol_RNAbd 4.72
PF13304AAA_21 4.72
PF01757Acyl_transf_3 4.72
PF13707RloB 4.72
PF14520HHH_5 2.83
PF12327FtsZ_C 1.89
PF02580Tyr_Deacylase 0.94
PF00950ABC-3 0.94
PF00132Hexapep 0.94
PF12697Abhydrolase_6 0.94
PF136224HBT_3 0.94
PF08323Glyco_transf_5 0.94
PF03717PBP_dimer 0.94
PF00480ROK 0.94
PF02875Mur_ligase_C 0.94
PF08713DNA_alkylation 0.94
PF10593Z1 0.94
PF10703MoaF 0.94
PF03129HGTP_anticodon 0.94
PF14450FtsA 0.94
PF00579tRNA-synt_1b 0.94
PF01225Mur_ligase 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0058Glucan phosphorylaseCarbohydrate transport and metabolism [G] 6.60
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.89
COG0609ABC-type Fe3+-siderophore transport system, permease componentInorganic ion transport and metabolism [P] 0.94
COG49123-methyladenine DNA glycosylase AlkDReplication, recombination and repair [L] 0.94
COG4606ABC-type enterochelin transport system, permease componentInorganic ion transport and metabolism [P] 0.94
COG1490D-aminoacyl-tRNA deacylaseTranslation, ribosomal structure and biogenesis [J] 0.94
COG1108ABC-type Mn2+/Zn2+ transport system, permease componentInorganic ion transport and metabolism [P] 0.94
COG0773UDP-N-acetylmuramate-alanine ligase MurC and related ligases, MurC/Mpl familyCell wall/membrane/envelope biogenesis [M] 0.94
COG0770UDP-N-acetylmuramyl pentapeptide synthaseCell wall/membrane/envelope biogenesis [M] 0.94
COG0769UDP-N-acetylmuramyl tripeptide synthaseCell wall/membrane/envelope biogenesis [M] 0.94
COG0768Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2)Cell cycle control, cell division, chromosome partitioning [D] 0.94
COG0442Prolyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.94
COG0441Threonyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.94
COG0438Glycosyltransferase involved in cell wall bisynthesisCell wall/membrane/envelope biogenesis [M] 0.94
COG0423Glycyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 0.94
COG0297Glycogen synthaseCarbohydrate transport and metabolism [G] 0.94
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.94
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.94
COG0124Histidyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908012|sp300_12702438All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae5234Open in IMG/M
3300006292|Ga0099622_115333All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1890Open in IMG/M
3300007268|Ga0104869_107984All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae772Open in IMG/M
3300007278|Ga0104339_108895All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae586Open in IMG/M
3300007284|Ga0104752_111407All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1112Open in IMG/M
3300007287|Ga0104873_100341All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27913635Open in IMG/M
3300007295|Ga0104867_1000504All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27925174Open in IMG/M
3300007295|Ga0104867_1007217All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales3905Open in IMG/M
3300007297|Ga0104793_101207All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas18596Open in IMG/M
3300007300|Ga0104843_101951All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27910364Open in IMG/M
3300007316|Ga0104922_100112All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27968993Open in IMG/M
3300007320|Ga0104940_1000802All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27921653Open in IMG/M
3300007339|Ga0104971_101140All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27911845Open in IMG/M
3300007347|Ga0104340_101100All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27910055Open in IMG/M
3300007368|Ga0104977_1003315All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2798454Open in IMG/M
3300007531|Ga0105502_1022382All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1634Open in IMG/M
3300007638|Ga0105526_1000337All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27942447Open in IMG/M
3300007659|Ga0105537_100089All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27929624Open in IMG/M
3300007662|Ga0105539_114667All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae924Open in IMG/M
3300007746|Ga0105776_1000040All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27959076Open in IMG/M
3300007803|Ga0105780_100814All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27917859Open in IMG/M
3300007938|Ga0114251_104602All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1462Open in IMG/M
3300007967|Ga0105958_105813All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1647Open in IMG/M
3300007980|Ga0114366_1011129All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2017Open in IMG/M
3300008061|Ga0111056_103926All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1483Open in IMG/M
3300008080|Ga0105957_100798All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27922573Open in IMG/M
3300008098|Ga0114255_102458All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2799596Open in IMG/M
3300008099|Ga0114261_102253All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2797607Open in IMG/M
3300008104|Ga0114288_100094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27930082Open in IMG/M
3300008128|Ga0114847_101301All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27910203Open in IMG/M
3300008131|Ga0111081_105011All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp.3979Open in IMG/M
3300008133|Ga0111365_114881All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1852Open in IMG/M
3300008134|Ga0111464_100025All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279115867Open in IMG/M
3300008136|Ga0113979_104454All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2798057Open in IMG/M
3300008143|Ga0114287_136337All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae787Open in IMG/M
3300008155|Ga0114001_102119All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27911608Open in IMG/M
3300008155|Ga0114001_104952All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2795523Open in IMG/M
3300008273|Ga0114250_106986All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas3466Open in IMG/M
3300008275|Ga0114253_1001335All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27914371Open in IMG/M
3300008276|Ga0114259_1000919All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27911726Open in IMG/M
3300008278|Ga0114262_124303All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1002Open in IMG/M
3300008279|Ga0114263_1004003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae3478Open in IMG/M
3300008406|Ga0115224_1000105All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27989934Open in IMG/M
3300008406|Ga0115224_1014559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1834Open in IMG/M
3300008436|Ga0115418_105938All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2432Open in IMG/M
3300008474|Ga0115375_100135All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27933090Open in IMG/M
3300008480|Ga0115173_1073203All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae674Open in IMG/M
3300008489|Ga0111007_100440All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27921197Open in IMG/M
3300008493|Ga0111009_1001281All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27914195Open in IMG/M
3300008498|Ga0115079_105381All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1461Open in IMG/M
3300008506|Ga0115176_1001832All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27916625Open in IMG/M
3300008524|Ga0111046_101966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2799258Open in IMG/M
3300008541|Ga0111054_100008All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279246999Open in IMG/M
3300008565|Ga0111061_1000121All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27940408Open in IMG/M
3300008639|Ga0115685_1001590All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27917535Open in IMG/M
3300008650|Ga0111455_1004455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp.5158Open in IMG/M
3300008660|Ga0111492_104945All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2146Open in IMG/M
3300008727|Ga0113884_1025155All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae851Open in IMG/M
3300008734|Ga0113998_100043All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas156275Open in IMG/M
3300008742|Ga0115672_107480All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales3880Open in IMG/M
3300008748|Ga0114085_100145All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27949131Open in IMG/M
3300008748|Ga0114085_120347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1081Open in IMG/M
3300008754|Ga0114089_100476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27930169Open in IMG/M
3300011982|Ga0119773_1003995All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas4439Open in IMG/M
3300013749|Ga0119799_101575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27910777Open in IMG/M
3300013751|Ga0119802_1000003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279275893Open in IMG/M
3300014090|Ga0134343_101554All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1514Open in IMG/M
3300014815|Ga0119815_1000665All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27928370Open in IMG/M
7000000005|SRS022536_LANL_scaffold_111318All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae3244Open in IMG/M
7000000008|C2613933All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae647Open in IMG/M
7000000014|SRS017814_Baylor_scaffold_27616All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae3839Open in IMG/M
7000000025|C3212007All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales4767Open in IMG/M
7000000042|SRS023835_Baylor_scaffold_50313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2540Open in IMG/M
7000000058|SRS064774_LANL_scaffold_64435All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2458Open in IMG/M
7000000086|SRS049147_LANL_scaffold_16619All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2539Open in IMG/M
7000000118|SRS024289_LANL_scaffold_62003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales5248Open in IMG/M
7000000125|SRS015941_WUGC_scaffold_74970All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1207Open in IMG/M
7000000127|SRS023926_Baylor_scaffold_58980All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae660Open in IMG/M
7000000139|C2154051All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae514Open in IMG/M
7000000203|C3038517All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae631Open in IMG/M
7000000203|SRS024441_LANL_scaffold_30155All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas2283Open in IMG/M
7000000205|SRS011247_Baylor_scaffold_24502All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae3870Open in IMG/M
7000000207|C2029464All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae622Open in IMG/M
7000000228|SRS022602_Baylor_scaffold_97126All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1605Open in IMG/M
7000000244|SRS016575_Baylor_scaffold_61196All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas gingivalis16907Open in IMG/M
7000000253|SRS054569_LANL_scaffold_18396All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae4437Open in IMG/M
7000000274|SRS052876_LANL_scaffold_39350All Organisms → cellular organisms → Bacteria5670Open in IMG/M
7000000292|SRS023958_Baylor_scaffold_16988All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1173Open in IMG/M
7000000316|SRS017511_Baylor_scaffold_33426All Organisms → cellular organisms → Bacteria20111Open in IMG/M
7000000396|SRS049268_LANL_scaffold_46261All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1429Open in IMG/M
7000000406|SRS024381_LANL_scaffold_71727All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae3777Open in IMG/M
7000000436|C1941758All Organisms → Viruses → Predicted Viral2289Open in IMG/M
7000000438|C1216971All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae802Open in IMG/M
7000000496|SRS057692_LANL_scaffold_43061All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae657Open in IMG/M
7000000510|SRS053917_LANL_scaffold_77188All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2724Open in IMG/M
7000000523|SRS019126_WUGC_scaffold_24026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae844Open in IMG/M
7000000554|SRS058336_LANL_scaffold_35531All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae664Open in IMG/M
7000000561|SRS057355_LANL_scaffold_18987All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae592Open in IMG/M
7000000574|SRS017691_Baylor_scaffold_1346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales29584Open in IMG/M
7000000598|C1764221All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae648Open in IMG/M
7000000599|SRS019022_WUGC_scaffold_25573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales51710Open in IMG/M
7000000607|C815428All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae743Open in IMG/M
7000000618|SRS062544_LANL_scaffold_63279All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas gingivalis9582Open in IMG/M
7000000670|C4860878All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1702Open in IMG/M
7000000676|SRS018665_WUGC_scaffold_59576All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. KLE 12803994Open in IMG/M
7000000738|SRS015470_WUGC_scaffold_25144All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae747Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
HumanHost-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human46.23%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human30.19%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human15.09%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral2.83%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Palatine Tonsils → Human1.89%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral0.94%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human0.94%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral0.94%
Subgingival PlaqueHost-Associated → Human → Digestive System → Oral Cavity → Unclassified → Subgingival Plaque0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908012Human Subgingival plaque microbiome from visit number 1 of subject 763496533Host-AssociatedOpen in IMG/M
3300006292Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 809635352Host-AssociatedOpen in IMG/M
3300007268Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 763840445 reassemblyHost-AssociatedOpen in IMG/M
3300007278Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160319967 reassemblyHost-AssociatedOpen in IMG/M
3300007284Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159490532 reassemblyHost-AssociatedOpen in IMG/M
3300007287Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 158742018 reassemblyHost-AssociatedOpen in IMG/M
3300007295Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159814214 reassemblyHost-AssociatedOpen in IMG/M
3300007297Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158337416 reassemblyHost-AssociatedOpen in IMG/M
3300007300Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160603188 reassemblyHost-AssociatedOpen in IMG/M
3300007316Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159571453 reassemblyHost-AssociatedOpen in IMG/M
3300007320Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158479027 reassemblyHost-AssociatedOpen in IMG/M
3300007339Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763820215 reassemblyHost-AssociatedOpen in IMG/M
3300007347Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764649650 reassemblyHost-AssociatedOpen in IMG/M
3300007368Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158499257 reassemblyHost-AssociatedOpen in IMG/M
3300007531Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764224817 reassemblyHost-AssociatedOpen in IMG/M
3300007638Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159915365 reassemblyHost-AssociatedOpen in IMG/M
3300007659Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 160158126 reassemblyHost-AssociatedOpen in IMG/M
3300007662Human throat microbial communities from NIH, USA - visit 2, subject 765560005 reassemblyHost-AssociatedOpen in IMG/M
3300007746Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160502038 reassemblyHost-AssociatedOpen in IMG/M
3300007803Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763435843 reassemblyHost-AssociatedOpen in IMG/M
3300007938Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 158479027 reassemblyHost-AssociatedOpen in IMG/M
3300007967Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160582958 reassemblyHost-AssociatedOpen in IMG/M
3300007980Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159207311 reassemblyHost-AssociatedOpen in IMG/M
3300008061Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159571453 reassemblyHost-AssociatedOpen in IMG/M
3300008080Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763759525 reassemblyHost-AssociatedOpen in IMG/M
3300008098Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764224817 reassemblyHost-AssociatedOpen in IMG/M
3300008099Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763820215 reassemblyHost-AssociatedOpen in IMG/M
3300008104Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 158499257 reassemblyHost-AssociatedOpen in IMG/M
3300008128Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159713063 reassemblyHost-AssociatedOpen in IMG/M
3300008131Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159713063 reassemblyHost-AssociatedOpen in IMG/M
3300008133Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763840445 reassemblyHost-AssociatedOpen in IMG/M
3300008134Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159571453 reassemblyHost-AssociatedOpen in IMG/M
3300008136Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764811490 reassemblyHost-AssociatedOpen in IMG/M
3300008143Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158499257 reassemblyHost-AssociatedOpen in IMG/M
3300008155Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 370425937 reassemblyHost-AssociatedOpen in IMG/M
3300008273Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 158883629 reassemblyHost-AssociatedOpen in IMG/M
3300008275Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764447348 reassemblyHost-AssociatedOpen in IMG/M
3300008276Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763860675 reassemblyHost-AssociatedOpen in IMG/M
3300008278Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764649650 reassemblyHost-AssociatedOpen in IMG/M
3300008279Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 338793263 reassemblyHost-AssociatedOpen in IMG/M
3300008406Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765701615 reassemblyHost-AssociatedOpen in IMG/M
3300008436Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 370425937 reassemblyHost-AssociatedOpen in IMG/M
3300008474Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 158944319 reassemblyHost-AssociatedOpen in IMG/M
3300008480Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 160158126 reassemblyHost-AssociatedOpen in IMG/M
3300008489Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764811490 reassemblyHost-AssociatedOpen in IMG/M
3300008493Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763901136 replicate 2 reassemblyHost-AssociatedOpen in IMG/M
3300008498Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160178356 reassemblyHost-AssociatedOpen in IMG/M
3300008506Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 159510762 reassemblyHost-AssociatedOpen in IMG/M
3300008524Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160319967 reassemblyHost-AssociatedOpen in IMG/M
3300008541Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 604812005 reassemblyHost-AssociatedOpen in IMG/M
3300008565Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158499257 reassemblyHost-AssociatedOpen in IMG/M
3300008639Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764083206 reassemblyHost-AssociatedOpen in IMG/M
3300008650Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764143897 reassemblyHost-AssociatedOpen in IMG/M
3300008660Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 604812005 reassemblyHost-AssociatedOpen in IMG/M
3300008727Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 338793263 reassemblyHost-AssociatedOpen in IMG/M
3300008734Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765013792 reassemblyHost-AssociatedOpen in IMG/M
3300008742Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159814214 reassemblyHost-AssociatedOpen in IMG/M
3300008748Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160178356 reassemblyHost-AssociatedOpen in IMG/M
3300008754Human palatine tonsils microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300011982Human oral microbial communities from Beijing, China - VLP3Host-AssociatedOpen in IMG/M
3300013749Human oral microbial communities from Los Angeles, CA, USA - S13-03-RHost-AssociatedOpen in IMG/M
3300013751Human oral microbial communities from Los Angeles, CA, USA - S14-02-DHost-AssociatedOpen in IMG/M
3300014090Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_099Host-AssociatedOpen in IMG/M
3300014815Human oral microbial communities from Los Angeles, CA, USA - S21-03-RHost-AssociatedOpen in IMG/M
7000000005Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 809635352Host-AssociatedOpen in IMG/M
7000000008Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159814214Host-AssociatedOpen in IMG/M
7000000014Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160603188Host-AssociatedOpen in IMG/M
7000000025Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 159005010Host-AssociatedOpen in IMG/M
7000000042Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 158883629Host-AssociatedOpen in IMG/M
7000000058Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764062976Host-AssociatedOpen in IMG/M
7000000086Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159227541Host-AssociatedOpen in IMG/M
7000000118Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158944319Host-AssociatedOpen in IMG/M
7000000125Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764325968Host-AssociatedOpen in IMG/M
7000000127Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159268001Host-AssociatedOpen in IMG/M
7000000139Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159207311Host-AssociatedOpen in IMG/M
7000000203Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159571453Host-AssociatedOpen in IMG/M
7000000205Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 158742018Host-AssociatedOpen in IMG/M
7000000207Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 158742018Host-AssociatedOpen in IMG/M
7000000228Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158499257Host-AssociatedOpen in IMG/M
7000000244Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159915365Host-AssociatedOpen in IMG/M
7000000253Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 160158126Host-AssociatedOpen in IMG/M
7000000274Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 737052003Host-AssociatedOpen in IMG/M
7000000292Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159369152Host-AssociatedOpen in IMG/M
7000000316Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160502038Host-AssociatedOpen in IMG/M
7000000396Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 604812005Host-AssociatedOpen in IMG/M
7000000406Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159713063Host-AssociatedOpen in IMG/M
7000000436Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764487809Host-AssociatedOpen in IMG/M
7000000438Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 763496533Host-AssociatedOpen in IMG/M
7000000496Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 160158126Host-AssociatedOpen in IMG/M
7000000510Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 370425937Host-AssociatedOpen in IMG/M
7000000523Human palatine tonsils microbial communities from NIH, USA - visit 2, subject 763496533Host-AssociatedOpen in IMG/M
7000000554Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764447348Host-AssociatedOpen in IMG/M
7000000561Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763860675Host-AssociatedOpen in IMG/M
7000000574Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160582958Host-AssociatedOpen in IMG/M
7000000598Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159207311Host-AssociatedOpen in IMG/M
7000000599Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763961826 replicate 1Host-AssociatedOpen in IMG/M
7000000607Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765337473Host-AssociatedOpen in IMG/M
7000000618Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 763536994Host-AssociatedOpen in IMG/M
7000000670Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160158126Host-AssociatedOpen in IMG/M
7000000676Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765013792Host-AssociatedOpen in IMG/M
7000000738Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764083206 replicate 2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
sp300_003715802124908012Subgingival PlaqueMWGALEPAGPTGALYEPAVSVEAHIGELQAGGIAHRSLFAFGGSNVLAVAELGAEAPHAIDMYDITLCKPLSELFAEELEYAFNFGA
Ga0099622_11533323300006292HumanMAEELAKAPLTALSRARVAAMWSALEPAGPTGALYESAVCVEAHIGELQTGGIACRGLFAFGRRDLLAVAELGAEAPHAINMYDIALCKPLSELFAKELEYAFNFGA*
Ga0104869_10798413300007268HumanVQDLGRAVEPAGPPGALYESAVCVEAHIGELQTGGIACRGLFAFGGSNILAVAELGAEAPHAINMYDIALCKPLSELFAKELEYAFNFGA*
Ga0104339_10889513300007278HumanLEPADPTGTLYESAVCVEAHIGELQAGGIARRGLFAFGRRDLLAVAELGAEAPYAIDMYDIAVCEPLSELFAKELEYAFNFGA*
Ga0104752_11140723300007284HumanMRGTLESAGPTGALHEPAVSVEAHIGELQAGGIVRRSLFAFGGSNVLAVAELGAKAPYAIDMYDIAVCEPLSELFAKELEYAFNFGA*
Ga0104873_10034153300007287HumanMWSALEPAGPTGALYESAVCVEAHIGYLQTGGIACRGLFAFGRRDLLAVAELGAEAPHAINMYDIALCKPLSELFGEELEYAFNFGA*
Ga0104867_100050493300007295HumanMWSTLEPAGPTGALYEPAVCVEAHIGELQAGSIARRGLFAFGRSNVLAVAELGAKAPHAIDMYDIALCKPLSELFAEELEYAFNFGA*
Ga0104867_100721713300007295HumanMRGALEPAGPTGALHEPAVSVEAHIAYLQAGGIARRGLFAFGGSNLFAVAELGAEAPHAIDIYDIALCEPLSELFAEELEYAFNFGA*
Ga0104793_101207113300007297HumanMRGALEPAGPTGALYEPAVSVEAHIGELQAGGIACRSLFAFGGSNVLAVAELGAEAPHAIDMYDIAVCEPLSELFGEELEYAFNLGA*
Ga0104843_10195113300007300HumanVCVWGGAGEPGGSAGAWREPVVSMEAHIGYLQAGGIARRGLFTFGGRHLLAVAELGAEAPHAINMYDIALCKPLSELFAKELEYAFNFGA*
Ga0104922_10011213300007316HumanMRGALEPADPTGALYEPAVCVEAHIGELQAGSIACRGLFAFGGRDLLAVAELGAEAPHAINMYDIAVCEPLSELFAEELEYAFNFGA*
Ga0104940_100080233300007320HumanMRGTLESAGPTGALHEPAVSVEAHIGELQAGGIACRGLFAFGGSNLLAVAELGAEAPHAIDMYDIALCEPLSELFAEELEYAFNFGA*
Ga0104971_10114013300007339HumanMWSALEPAGPTGALYESAVCVEAHIGELQTGGIARRSLFAFEGRDLLAVAELGAEAPHAIDMYDIALCEPLRELFAEELEYAFNFGA*
Ga0104340_10110053300007347HumanMRGTLEPAGSTGALHEPVVSMEAHIGYLQAGGIARRGLFTFGGRHLLAVAELGAEAPHAIDMHDIALCEPLSELFTEELEYAFNFGA*
Ga0104977_100331533300007368HumanMRGALEPAGPTGALYEPTVSVEAHIGYLQAGGIARRGLFAFGGSNLLAVAELGAKAPYAIDMYDIALCEPLRELFAEELEYAFNFGA*
Ga0105502_102238213300007531HumanMRGALEPADPTGALYESVVSVEAHIGELQAGGIACRSLFAFGGSNLLAVAELGAEAPHAIDMYDIAVCEPLSELFAEELEYAFNFSA*
Ga0105526_100033773300007638HumanMRGTLEPAGPTGALYEPTVSVEAHIGELQAGGIACRGLFAFGGRDLLAVAELGAEAPHTIDMHDISLCKPLSELFAEELEYAFNFGA*
Ga0105537_10008963300007659HumanMRGALEPADPTGTLYESVVSVEAYIGELQAGGISRRDLFALGWSNVLAVAELGAEASHAIDMYDIAVCEPLSELFTEELEYAFNFSA*
Ga0105539_11466713300007662HumanMWGALEPAGPTGALYESAVCVEAHIGELQTGGIACRGLFAFEGSNALAVAELGAEAPHAIDMHDIAVCKPLSELFAEELEYTFNFGA*
Ga0105776_1000040283300007746HumanMWGALEPAGPTGALHEPAVSMEAHIGELQTGGIARRGLFTFGGSNVLEVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA*
Ga0105780_10081483300007803HumanMWSALEPAGPTGALYESAVCVEAHIGELQTGGIACHGLFAFEGSNVLAVAELGAEAPHAINMYDIAVCEPLSKLFAKELEYAFNFGA*
Ga0114251_10460223300007938HumanMWSALEPAGPTGALYEPAVCVEAHIGELQTGGIVCRCLFAFGGSNLLAVAELGAEAPHAIDMYDIAICEPLSELFAKELEYAFN
Ga0105958_10581323300007967HumanMAEELAKAPLTALSRARVAAMWSALEPAGPTGALYESAVCVEAHIGELQTGGIVRRSLFAFGGSNVLAVAELGAEAPHAIDMHDIAVCEPLSELFAEELEYAFNFGA*
Ga0114366_101112913300007980HumanMRGTLEPAGPTGALHEPTVSVEAHIGELQAGGIACRCLFAFGGRDLLAVAELGAKAPYAIDMYDIALCEPLSELFAEELEYAFNFGA*
Ga0111056_10392613300008061HumanMRGALEPADPTGALYEPAVCVEAHIGELQAGGIAHRGLFAFGGSNLLAVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA*
Ga0105957_10079853300008080HumanMRGTLEPAGSTGALHEPVVSMEAHIGYLQAGGIARRGLFTFGGRHLLAVAELGAEAPHAIDMHDIALCDPLSELFTEELEYAFNFGA*
Ga0114255_10245883300008098HumanMWSALEPAGPTGALYESAVCVEAHIGYLQTGGIARRGLFAFEGSNVLAVAELGAKAPYAINMYDIALCKPLSELFAEELEYAFNFGA*
Ga0114261_10225333300008099HumanMRGTLEPAGSTGALHEPAVSMEAHIGYLQAGGIACRDLFTFGGRHLLAVAELGAEAPHAIDMHDIALCEPLSELFTEELEYAFNFGA*
Ga0114288_10009423300008104HumanMRGALESADPTGALYEPTVSVEAHIGYLQAGGIARRGLFAFGGSNVLAVAELGAKAPHAIDIYDIALCKPLSELFAEELEYAFNFGA*
Ga0114847_10130123300008128HumanMWGTLEPAGSTGALYEPAVCVEAHIGELQAGSIARRGFFAFGGSNVLAVAELGAKAPHAINMYDIAVCEPLSELFAEELEYAFNFGA*
Ga0111081_10501123300008131HumanMWSALEPAGPTGALYEPAVCVEAHIGYLQAGGIAHRGLFAFGGSNLLAVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA*
Ga0111365_11488113300008133HumanMWSALEPAGPTGALYESAVCVEAHIGELQTGGIACRGLFAFGGSNILAVAELGAEAPHAINMYDIALCKPLSELFAKELEYAFNFGA*
Ga0111464_100025243300008134HumanMRGTLEPAGPTGALHEPAVSVEAHIGELQAGGIAHRGLFAFGGSNLLAVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA*
Ga0113979_10445423300008136HumanMRGTLEPAGSTGALYKPAVSMEAHIGELQTGGIAGRGLFALRGGDLLAGGPXXXXCAFGRRDLLAVAELGAEAPHAINMYDIALCKPLSELFAKELEYAFNFGA*
Ga0114287_13633713300008143HumanMWGTLEPAGSTGALYEPAVCVEAHIGELQAGSIARRGFFAFGGSNVLAVAELGAKAPHAINMYDIAVCEPLSEL
Ga0114001_10211933300008155HumanMRGALEPAGPTGAMNESVVSVESYIGELQAGGIACRALFAFGGSNVLAVAELGAEAPHAIDMHDIALCKPLSELFAEELEYTFNFGA*
Ga0114001_10495223300008155HumanMWGALELAGPTGVLYESTVCVEAHIGYLQAGGIARRGLFAFGGSNLLAVAELGAKAPYAIDMYDIALSKPLSELFAEELEYAFNFGA*
Ga0114250_10698623300008273HumanMAEELAKAPLTALSRARVAAMRGTLEPAGPTGALYEPAVCVEAHIGELQAGSIACRGLFAFGGRHLLAVAELGAEAPHAIDMYDIALCEPLSELFAEELEYAFNFGA*
Ga0114253_100133533300008275HumanMWSALEPAGPTGALYESAVCVEAHIGYLQTGGIACRGLFAFEGSNVLAVAELGAEAPHAINMYDIAVCEPLSELFAKELEYAFNFGA*
Ga0114259_100091963300008276HumanMRGALEPADPTGALYESVVSEEAHIGELQAGGISRRDLFALGWSNVLAVAELGAEAPHAIDMYDIAVCEPLSELFGEELEYAFNFGA*
Ga0114262_12430313300008278HumanMWSTLEPAGPTGALYEPAVCVEAHIGELQAGSIARRGLFAFGRSNVLAVAELGAKAPHAIDMSLCKPLSELFAEELEYAFNFGA*
Ga0114263_100400343300008279HumanMRGTLEPAGSTGALYKPAVSMEAHIGELQTGGIACRGLFAFGRRDLLAVAELGAEAPHAINMYDIALCKPLSELFAKELEYAFNFGA*
Ga0115224_100010543300008406HumanMGALYESAVCVEAHIGELQTGGIVCRCLFAFGGSNLLAVAELGAEAPHAIDMYDIAICEPLSELFAKELEYAFNFGA*
Ga0115224_101455913300008406HumanMWSALELAGPTGALYEPAVSVEAHIGYLQAGGIARRGLFAFGGSNVLAVAELGAEAPHAIYMYDIAVCEPLSELFAEELEYAFNFSA*
Ga0115418_10593813300008436HumanMRGALEPAGPTGALYEPAVSVEAHIGELQAGGIARRGLFAFGGSNVLAVAELGAKAPYAIDMYDIALCEPLSELFAEKLEYAFNFGA*
Ga0115375_10013563300008474HumanMRGTLEPAGPTGALYEPTVSVEAHIGELQAGGIACRSLFAFGGSNVLAVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA*
Ga0115173_107320313300008480HumanVAVMRGTLEPAGPTGALHEPAVCMEAHIGELQAGRIARRSLFAFGGSNVLAVAELGAKAPYAIDMYDIALCKPLSELFGEELEYAFNFGA*
Ga0111007_10044073300008489HumanMQGALEPADPTGALYESAVSVEAHIGELQAGGIVRRSLFAFGGSNVLAVAELGAEAPHAIDMHDIAVCEPLSELFAEELEHAFNLGA*
Ga0111009_100128193300008493HumanMRGALEPAGPTGALYESAVCVEAHIGELQTGGIACRGLFAFGRRDLLAVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA*
Ga0115079_10538123300008498HumanMRGALQPAGPTGALYESAVCVEAHIGELQAGGIVCRCLFAFGGSNLLAVAKLRAEAPHAIDMYDIALCEPLSELFAEELEYAFNFGA*
Ga0115176_1001832153300008506HumanMWGALEPAGPTGALYEPAVSVEAHIGELQAGGIANRGLFAFGWSNVLAVAELGAKAPHAIDMYDIAVCEPLSELFAEELEYAFNFGA*
Ga0111046_10196663300008524HumanMLSTLEPAGPMGALHEPAVSVEAHIGELQTGGIARRGLFAFGGSNVLAVAELGAEAPHAIYMYDIAVCKPLSKLFAEELEYAFNLGA*
Ga0111054_100008673300008541HumanMRGTLEPTGPTGALYESTVCVEAHIGYLQAGSIARLALFAFGGRHLLAVAEFGAEAPHAIDMYDIAVCEPLSELFAEELEYAFNFGA*
Ga0111061_100012163300008565HumanMWGALEPAGPTGALYEPAVSVEAHIGELQAGGIAHRSLFAFGGSNVLAVAELGAEAPHAIDMYDITLCKPLSELFAEELEYAFNFGA*
Ga0115685_100159053300008639HumanMRGALEPADPTGALYESAVCVEAHIGELQAGGIACRSLFAFGGSNVLAVAELGAEAPHAIDMYDIAVCEPLSELFAEELEYAFNLGA*
Ga0111455_100445533300008650HumanTGALHEPAVSVEAHIGELQAGGIACRGLFAFGGSNLLAVAELGAEAPHAIDMYDIALCEPLSELFAEELEYAFNFGA*
Ga0111492_10494523300008660HumanMRGALEPADPTGALYESVVSVEAHIGELQAGGIACRGLFAFGGSNLLAVAELGAEAPHAIDMYDIAVCEPLSELFAEELEYAFNFSA*
Ga0113884_102515513300008727HumanAGERARAPLTTLSRARVAVMRSTLEPAGPTGALHEPAVSMEAHIGELQTGGIARRGLFTFGGSNVLEVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA*
Ga0113998_1000431193300008734HumanMWSALELAGPTGALYESAVCVEAHIGELQTGGIARRGLFAFGGRHLLAVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA*
Ga0115672_10748043300008742HumanMRGALEPAGPTGALHEPAVSVEAHIAYLQAGGIARRGLFAFGGSNLFAVAELGAEAPHAIDMYDIALCKPLSELFAEELE
Ga0114085_10014523300008748HumanMWSALEPAGSTGALHEPAVCVEAHIGELQAGGIARRGLFAFGGSNLLAVAKLGAEAPHAIDMHDIAVCEPLRELFTEKLEYAFNFGA*
Ga0114085_12034713300008748HumanMWSALEPAGPTGALYESAVCVEAHIGELQAGGIVCRCLFAFGGSNLLAVAKLRAEAPHAIDMYDIALCEPLSELFAEELEYAFNFGA*
Ga0114089_100476233300008754HumanMRGALEPADPTGALYESAVCVEAHIGELQAGGIACRSLFAFEWSNVLAVAELGAKAPHAINMYDIAVCEPLSELFAEELEYAFNLGA*
Ga0119773_100399523300011982Human OralMRGTLEPAGPTGALYESAVSMEAHIGELQAGGIARRGLFAFGRSNLLAVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA*
Ga0119799_10157573300013749Human OralMWGTLEPAGPTGALYESTVCVEAHIGELQAGGIARRSLFTFGGRHLLAVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA*
Ga0119802_10000031883300013751Human OralMRGTLEPAGPTGALHEPAVSVEAHIGYLQAGGIAHRGLFAFGGRHFLPVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA*
Ga0134343_10155423300014090Human OralMRGTLEPAGSTGALYKPAVSMEAHIGELQTGGIARRGLFAFGGSNVLAVAELGAEAPRAINMYDIALCKPLSELFAKELEYAFNFGA*
Ga0119815_100066583300014815Human OralMWSALEPAGPTGALYESTVCVEAHIGELQTGGIACRGLFAFEGSNVLAVAELGAEAPHAIDMYDIALCKPLSELFAKELEYAFNFGA*
SRS022536_LANL_scaffold_111318__gene_2453957000000005HumanMRGTLESAGPTGALHEPAVSVEAHIGELQAGGIACRGLFAFGGSNLLAVAELGAEAPHAIDMYDIALCEPLSELFAEELEYAFNXXXXXXX
C2613933__gene_435717000000008HumanEPAVCVEAHIGELQAGSIARRGLFAFGRSNVLAVAELGAKAPHAIDMYDIALCKPLSELFAEELEYAFNFGA
SRS017814_Baylor_scaffold_27616__gene_321757000000014HumanMRGTLESAGPTGALHEPAVSVEAHIGELQAGGIACRGLFAFGGSNLLAVAELGAEAPHAIDMYDIALCEPLSELFAEELEYAFNFGA
C3212007__gene_1710747000000025HumanMWSALEPAGPTGALYESAVCVEAHIGYLQTGGIACRGLFAFGRRDLLAVAELGAEAPHAINMYDIALCKPLSELFGEELEYAFNFGA
SRS023835_Baylor_scaffold_50313__gene_548907000000042HumanMAEELAKAPLTALSRARVAAMRGTLEPAGPTGALYEPAVCVEAHIGELQAGSIACRGLFAFGGRHLLAVAELGAEAPHAIDMYDIALCEPLSELFAEELEYAFNFGA
SRS064774_LANL_scaffold_64435__gene_894277000000058HumanMLSTLEPAGPMGALHEPAVSVEAHIGELQTGGIARRSLFAFEGRDLLAVAELGAEAPHAIDMYDIALCEPLRELFAEELE
SRS049147_LANL_scaffold_16619__gene_167007000000086HumanEPAVCVEAHIGELQAGSIACRGLFAFGGRDLLAVAELGAEAPHAINMYDIAVCEPLSELFAEELEYAFNFGA
SRS024289_LANL_scaffold_62003__gene_870517000000118HumanMRGTLEPAGPTGALYEPTVSVEAHIGELQAGGIACRSLFAFGGSNVLAVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA
SRS015941_WUGC_scaffold_74970__gene_995567000000125HumanMRGTLEPAGSTGALHEPAVSMEAHIGYLQAGGIARRGLFTFGGRHLLAVAELGAEAPHAIDMHDIALCEPLSELFTEELEYAFNFGA
SRS023926_Baylor_scaffold_58980__gene_824607000000127HumanMWSALEPAGPTGALYESAVCVEAHIGELQTGGIACHGLFAFEGSNVLAVAELGAEAPHAINMYDIAVCEPLSKLFAKELEYAFNFGA
C2154051__gene_723877000000139HumanACVAAMRGTLEPAGPTGALHEPTVSVEAHIGELQAGGIACRCLFAFGGRHLLAVAELGAEAPHAIDMHDIALCEPLSELFTEELEYAFNFGA
C3038517__gene_1446057000000203HumanMWSALEPAGPTGALYESAVCVEAHIGELQTGGIACRGLFAFEGSNVLAVAELGAEAPHAINMYDIAFCKPLSELFAKELEYAFNFGA
SRS024441_LANL_scaffold_30155__gene_360727000000203HumanMRGALEPADPTGALYEPAVCVEAHIGELQAGSIACRGLFAFGGRDLLAVAELGAEAPHAINMYDIAVCEPLSELFAEELEYAFNFGA
SRS011247_Baylor_scaffold_24502__gene_274857000000205HumanMWSALEPAGPTGALYESAVCVEAHIGYLQTGGIACRGLFAFGRRDLLAVAELGAEAPHAINMYDIALCKPLSELF
C2029464__gene_936177000000207HumanRARVAAMWSALEPAGPTGALYESAVCVEAHIGELQTGGIACRGLFAFGRRDLLAVAELGAEAPHAINMYDIALCKPLSELFGEELEYAFNFGA
SRS022602_Baylor_scaffold_97126__gene_1215867000000228HumanMRGALESADPTGALYESAVSVEAYIGELQTGGIAHRGLFAFGGSNVLAVAELGAKAPYAIDMYDIALCEPLRELFAEELEYAFNFGA
SRS016575_Baylor_scaffold_61196__gene_832987000000244HumanMRGTLEPAGPTGALYEPTVSVEAHIGELQAGGIACRGLFAFGGRDLLAVAELGAEAPHTIDMHDISLCKPLSELFAEELEYAFNFGA
SRS054569_LANL_scaffold_18396__gene_193977000000253HumanMRGALEPADPTGTLYESVVSVEAYIGELQAGGISRRDLFALGWSNVLAVAELGAEASHAIDMYDIAVCEPLSELFTEELEYAFNFSA
SRS052876_LANL_scaffold_39350__gene_477257000000274HumanMWSALEPAGPTGALHEPAVSMEAHIGELQAGCIAHRGLFAFGRRNVLAVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA
SRS023958_Baylor_scaffold_16988__gene_220217000000292HumanAKAPLTTLSRARVAAMRGALEPADPTGALYESAVCVEAHIGELQAGGIACRSLFAFGGSNVLAVAELGAEAPHAIDMYDIAVCEPLSELFAEELEYAFNLGA
SRS017511_Baylor_scaffold_33426__gene_348287000000316HumanMWGALEPAGPTGALHEPAVSMEAHIGELQTGGIARRGLFTFGGSNVLEVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA
SRS049268_LANL_scaffold_46261__gene_558057000000396HumanMRGTLEPTGPTGALYESTVCVEAHIGYLQAGSIARLALFAFGGRHLLAVAEFGAEAPHAIDMYDIAVCEPLSELFAEELEYAFNFGA
SRS024381_LANL_scaffold_71727__gene_988607000000406HumanMWSALEPAGPTGALYEPAVCVEAHIGYLQAGGIAHRGLFAFGGSNLLAVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA
C1941758__gene_1359237000000436HumanAPLTPLSRARVAAMRGALEPADPTGALYESVVSVEAHIGELQAGGIACRSLFAFGGSNLLAVAELGAEAPHAIDMYDIAVCEPLSELFAEELEYAFNFSA
C1216971__gene_602407000000438HumanLSRARVAAMRGALEPADPTGALYESVVSVEAHIGELQAGGIACRSLFAFGGSNLLAVAELGAEAPHAIDMYDIAVCEPLSELFAEELEYAFNFSA
SRS057692_LANL_scaffold_43061__gene_558707000000496HumanSRARVAAMRGALEPADPTGTLYESVVSVEAYIGELQAGGISRRDLFALGWSNVLAVAELGAEASHAIDMYDIAVCEPLSELFTEELEYAFNFSA
SRS053917_LANL_scaffold_77188__gene_1675847000000510HumanMWGALELAGPTGVLYESTVCVEAHIGYLQAGGIARRALFAFGGSNLLAVAELGAKAPYAIDMYDIALSKPLSELFAEELEYTFNFGA
SRS019126_WUGC_scaffold_24026__gene_313997000000523HumanMRGALEPADPTGALYESAVCVEAHIGELQAGGIACRSLFAFEWSNVLAVAELGAKAPHAINMYDIAVCEPLSELFAEELEYAFNLGA
SRS058336_LANL_scaffold_35531__gene_431947000000554HumanMWSALEPAGPTGALYESAVCVEAHIGYLQTGGIACRGLFAFEGSNVLAVAELGAEAPHAINMYDIAVCEPLSELFAKELEYAFNFGA
SRS057355_LANL_scaffold_18987__gene_129367000000561HumanMRGALEPADPTGALYESVVSEEAHIGELQAGGISRRDLFALGWSNVLAVAELGAEAPHAIDMYDIAVCEPLSELFGEELEYAFNFGA
SRS017691_Baylor_scaffold_1346__gene_12517000000574HumanMAEELAKAPLTALSRARVAAMWSALEPAGPTGALYESAVCVEAHIGELQTGGIVRRSLFAFGGSNVLAVAELGAEAPHAIDMHDIAVCEPLSELFAEELEYAFNFGA
C1764221__gene_1059277000000598HumanMRGTLEPAGPTGALHEPTVSVEAHIGELQAGGIACRCLFAFGGRDLLAVAELGAKAPYAIDMYDIALCEPLSELFAEELEYAFNFGA
SRS019022_WUGC_scaffold_25573__gene_241047000000599HumanMWSTLEPAGPTGALYEPAVCVEAHIGELQAGSIARRGLFAFGRSNVLAVAELGAKAPHAIDMYDIALCKPLSELFAEELEYAFNFGA
C815428__gene_324397000000607HumanAAMRGTLEPTGPTGALYESTVCVEAHIGYLQAGSIARLGLFAFGGRHLLAVAEFGAEAPHAIDMYDIAVCEPLSKLFAEELEYAFNFGA
SRS062544_LANL_scaffold_63279__gene_776727000000618HumanMAEELAKAPLTALSRARVAAMWSALEPAGPTGALYESAVCVEAHIGELQTGGIACRGLFAFGRRDLLAVAELGAEAPHAINMYDIALCKPLSELFAKELEYAFNFGA
C4860878__gene_2485877000000670HumanMRGTLEPAGPTGALHEPAVCMEAHIGELQAGRIARRSLFAFGGSNVLAVAELGAKAPYAIDMYDIALCKPLSELFGEELEYAFNFGA
SRS018665_WUGC_scaffold_59576__gene_771407000000676HumanMRGTLEPAGPTGALYEPTICVEAYIGYLQAGGIVRRCLFAFGGRDLLAVAELGAKAPYAIDMYDIALCEPLSELFAEELEYAFNFGA
SRS015470_WUGC_scaffold_25144__gene_281647000000738HumanGTLEPAGPTGALYEPAVSMEAYIGELQTGGIAHRGLFAFGGSNLLAVAELGAEAPHAIDMHDISLCKPLSELFAEELEYAFNFGA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.