NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F090517

Metagenome Family F090517

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090517
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 141 residues
Representative Sequence MNRRILSFCGLLLGLLFLASSCKNKKDTPRLELSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL
Number of Associated Samples 102
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 49.07 %
% of genes near scaffold ends (potentially truncated) 28.70 %
% of genes from short scaffolds (< 2000 bps) 70.37 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.222 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human
(42.593 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
(97.222 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 13.51%    β-sheet: 46.62%    Coil/Unstructured: 39.86%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF00133tRNA-synt_1 12.04
PF14129DUF4296 7.41
PF04413Glycos_transf_N 4.63
PF00749tRNA-synt_1c 3.70
PF07715Plug 2.78
PF08264Anticodon_1 2.78
PF00939Na_sulph_symp 0.93
PF00930DPPIV_N 0.93
PF06769YoeB_toxin 0.93
PF00593TonB_dep_Rec 0.93
PF08002DUF1697 0.93
PF01245Ribosomal_L19 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 12.04
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 12.04
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 12.04
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 12.04
COG15193-deoxy-D-manno-octulosonic-acid transferaseCell wall/membrane/envelope biogenesis [M] 4.63
COG0008Glutamyl- or glutaminyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 3.70
COG0335Ribosomal protein L19Translation, ribosomal structure and biogenesis [J] 0.93
COG0471Di- and tricarboxylate antiporterCarbohydrate transport and metabolism [G] 0.93
COG0823Periplasmic component TolB of the Tol biopolymer transport systemIntracellular trafficking, secretion, and vesicular transport [U] 0.93
COG1055Na+/H+ antiporter NhaD or related arsenite permeaseInorganic ion transport and metabolism [P] 0.93
COG1506Dipeptidyl aminopeptidase/acylaminoacyl peptidaseAmino acid transport and metabolism [E] 0.93
COG3797Uncharacterized conserved protein, DUF1697 familyFunction unknown [S] 0.93
COG4115Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB familyDefense mechanisms [V] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.22 %
UnclassifiedrootN/A2.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908010|kg300_3281692All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii568Open in IMG/M
2124908012|sp300_12693300All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii908Open in IMG/M
2124908012|sp300_12746036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales2393Open in IMG/M
3300006243|Ga0099348_110274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii875Open in IMG/M
3300006245|Ga0099369_106296All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1261Open in IMG/M
3300006247|Ga0099374_1000064All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27984930Open in IMG/M
3300006250|Ga0099391_127500All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii998Open in IMG/M
3300006251|Ga0099392_106740All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2897Open in IMG/M
3300006254|Ga0099365_1000329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27920222Open in IMG/M
3300006255|Ga0099353_1000843All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27913979Open in IMG/M
3300006260|Ga0099518_117562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1178Open in IMG/M
3300006291|Ga0099556_112264All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii655Open in IMG/M
3300006292|Ga0099622_100013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas catoniae252839Open in IMG/M
3300006297|Ga0099630_1012612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1047Open in IMG/M
3300006301|Ga0099617_135511All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii563Open in IMG/M
3300006307|Ga0099615_1000518All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27923889Open in IMG/M
3300006322|Ga0099623_1022574All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1524Open in IMG/M
3300006328|Ga0099580_111969All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1519Open in IMG/M
3300006328|Ga0099580_117900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii931Open in IMG/M
3300006458|Ga0100175_100299All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27945552Open in IMG/M
3300006742|Ga0101805_100743All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27910788Open in IMG/M
3300006898|Ga0102522_116610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii630Open in IMG/M
3300007107|Ga0102632_1036396All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii866Open in IMG/M
3300007107|Ga0102632_1051624Not Available581Open in IMG/M
3300007121|Ga0102671_140561All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii561Open in IMG/M
3300007122|Ga0102683_114217All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1113Open in IMG/M
3300007124|Ga0102685_102247All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27910097Open in IMG/M
3300007125|Ga0102700_1044533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii771Open in IMG/M
3300007127|Ga0103277_100103All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27919153Open in IMG/M
3300007167|Ga0102715_1035149All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii619Open in IMG/M
3300007194|Ga0103269_100108All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27978247Open in IMG/M
3300007284|Ga0104752_113796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii945Open in IMG/M
3300007285|Ga0102636_100273All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27927585Open in IMG/M
3300007287|Ga0104873_100683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2799289Open in IMG/M
3300007295|Ga0104867_1006985All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales3996Open in IMG/M
3300007295|Ga0104867_1027854All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1194Open in IMG/M
3300007309|Ga0104928_117263All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii692Open in IMG/M
3300007339|Ga0104971_125080All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii854Open in IMG/M
3300007347|Ga0104340_101114All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2799952Open in IMG/M
3300007367|Ga0104973_100688All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2798061Open in IMG/M
3300007531|Ga0105502_1032329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1102Open in IMG/M
3300007638|Ga0105526_1001331All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27914041Open in IMG/M
3300007659|Ga0105537_100631All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2799797Open in IMG/M
3300007663|Ga0105541_1025264All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii814Open in IMG/M
3300007803|Ga0105780_101374All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27912187Open in IMG/M
3300007803|Ga0105780_119329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1001Open in IMG/M
3300007828|Ga0105961_101808All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas2574Open in IMG/M
3300007938|Ga0114251_109237Not Available875Open in IMG/M
3300007940|Ga0114257_100320All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27936508Open in IMG/M
3300007978|Ga0111424_136772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii522Open in IMG/M
3300007994|Ga0113878_103015All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp.5656Open in IMG/M
3300008061|Ga0111056_115082All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii554Open in IMG/M
3300008131|Ga0111081_103536All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2795245Open in IMG/M
3300008143|Ga0114287_132680All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii882Open in IMG/M
3300008148|Ga0114323_1024085All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii813Open in IMG/M
3300008269|Ga0114154_114366All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1486Open in IMG/M
3300008270|Ga0114159_120034All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii538Open in IMG/M
3300008273|Ga0114250_102678All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2797163Open in IMG/M
3300008348|Ga0115412_102552All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1639Open in IMG/M
3300008415|Ga0115225_100241All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27923692Open in IMG/M
3300008483|Ga0105906_1014317All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1369Open in IMG/M
3300008506|Ga0115176_1057867All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii619Open in IMG/M
3300008524|Ga0111046_103902All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp.5255Open in IMG/M
3300008524|Ga0111046_129907All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii656Open in IMG/M
3300008565|Ga0111061_1000157All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27935831Open in IMG/M
3300008581|Ga0111080_136863All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii681Open in IMG/M
3300008611|Ga0111137_1027059All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1178Open in IMG/M
3300008615|Ga0111231_1006188All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1965Open in IMG/M
3300008639|Ga0115685_1026726All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1097Open in IMG/M
3300008679|Ga0115430_1049560All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii761Open in IMG/M
3300008695|Ga0113557_136908All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii718Open in IMG/M
3300008715|Ga0115609_1041008All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii707Open in IMG/M
3300008745|Ga0115673_1049307All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii510Open in IMG/M
3300008754|Ga0114089_131840All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii525Open in IMG/M
3300014038|Ga0119819_1096644All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii504Open in IMG/M
3300014106|Ga0134353_102730All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1233Open in IMG/M
3300014554|Ga0134345_101034All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2799893Open in IMG/M
7000000007|C3743270All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii633Open in IMG/M
7000000025|SRS023617_Baylor_scaffold_74304All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii929Open in IMG/M
7000000086|SRS049147_LANL_scaffold_61195All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii683Open in IMG/M
7000000128|SRS050244_LANL_scaffold_43035All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii505Open in IMG/M
7000000132|SRS012285_Baylor_scaffold_5238All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1473Open in IMG/M
7000000140|C2845143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii588Open in IMG/M
7000000156|C2452637Not Available509Open in IMG/M
7000000176|C2228983All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas4134Open in IMG/M
7000000195|SRS017209_Baylor_scaffold_1252All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii553Open in IMG/M
7000000203|SRS024441_LANL_scaffold_54814All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii650Open in IMG/M
7000000205|SRS011247_Baylor_scaffold_13865All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1970Open in IMG/M
7000000207|SRS011243_Baylor_scaffold_42417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii992Open in IMG/M
7000000208|SRS011126_Baylor_scaffold_66706All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1663Open in IMG/M
7000000274|SRS052876_LANL_scaffold_51901All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1209Open in IMG/M
7000000277|C1114912All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii544Open in IMG/M
7000000285|SRS023595_Baylor_scaffold_16918All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales5009Open in IMG/M
7000000336|SRS019073_WUGC_scaffold_14308All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas884Open in IMG/M
7000000349|C3249457All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii555Open in IMG/M
7000000395|SRS019077_WUGC_scaffold_2293All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii645Open in IMG/M
7000000404|C4344126All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii795Open in IMG/M
7000000406|SRS024381_LANL_scaffold_71051All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii881Open in IMG/M
7000000437|SRS013947_WUGC_scaffold_11274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii517Open in IMG/M
7000000439|SRS013942_WUGC_scaffold_6862All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii771Open in IMG/M
7000000461|SRS045127_LANL_scaffold_37032All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii664Open in IMG/M
7000000519|C3930440All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. KLE 1280989Open in IMG/M
7000000561|SRS057355_LANL_scaffold_8101All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1815Open in IMG/M
7000000576|C4051030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii662Open in IMG/M
7000000621|C1749332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii553Open in IMG/M
7000000666|C2913772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii623Open in IMG/M
7000000676|C3755057All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii945Open in IMG/M
7000000710|C2192944All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas2633Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
HumanHost-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human42.59%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human22.22%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human21.30%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Attached/Keratinized Gingiva → Human2.78%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Palatine Tonsils → Human1.85%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral1.85%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human1.85%
Subgingival PlaqueHost-Associated → Human → Digestive System → Oral Cavity → Unclassified → Subgingival Plaque1.85%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral0.93%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human0.93%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Saliva → Human0.93%
Keratinized GingivaHost-Associated → Human → Digestive System → Oral Cavity → Unclassified → Keratinized Gingiva0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908010Keratinized_gingiva_contig300Host-AssociatedOpen in IMG/M
2124908012Human Subgingival plaque microbiome from visit number 1 of subject 763496533Host-AssociatedOpen in IMG/M
3300006243Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 370425937Host-AssociatedOpen in IMG/M
3300006245Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159490532Host-AssociatedOpen in IMG/M
3300006247Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159005010Host-AssociatedOpen in IMG/M
3300006250Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159510762Host-AssociatedOpen in IMG/M
3300006251Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159369152Host-AssociatedOpen in IMG/M
3300006254Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 706846339Host-AssociatedOpen in IMG/M
3300006255Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 737052003Host-AssociatedOpen in IMG/M
3300006260Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159915365Host-AssociatedOpen in IMG/M
3300006291Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 604812005Host-AssociatedOpen in IMG/M
3300006292Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 809635352Host-AssociatedOpen in IMG/M
3300006297Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160603188Host-AssociatedOpen in IMG/M
3300006301Human buccal mucosa microbial communities from NIH, USA - visit 2 of subject 764224817Host-AssociatedOpen in IMG/M
3300006307Human subgingival plaque microbial communities from NIH, USA - visit 2, subject 764042746Host-AssociatedOpen in IMG/M
3300006322Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159551223Host-AssociatedOpen in IMG/M
3300006328Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763860675Host-AssociatedOpen in IMG/M
3300006458Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 764487809Host-AssociatedOpen in IMG/M
3300006742Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160158126Host-AssociatedOpen in IMG/M
3300006898Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160400887Host-AssociatedOpen in IMG/M
3300007107Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 158944319Host-AssociatedOpen in IMG/M
3300007121Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158944319Host-AssociatedOpen in IMG/M
3300007122Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763982056Host-AssociatedOpen in IMG/M
3300007124Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159268001Host-AssociatedOpen in IMG/M
3300007125Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 675950834Host-AssociatedOpen in IMG/M
3300007127Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 763435843Host-AssociatedOpen in IMG/M
3300007167Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764042746Host-AssociatedOpen in IMG/M
3300007194Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 550534656Host-AssociatedOpen in IMG/M
3300007284Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159490532 reassemblyHost-AssociatedOpen in IMG/M
3300007285Human attached/keratinized gingiva microbial communities from NIH, USA - visit 1, subject 763496533Host-AssociatedOpen in IMG/M
3300007287Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 158742018 reassemblyHost-AssociatedOpen in IMG/M
3300007295Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159814214 reassemblyHost-AssociatedOpen in IMG/M
3300007309Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159247771 reassemblyHost-AssociatedOpen in IMG/M
3300007339Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763820215 reassemblyHost-AssociatedOpen in IMG/M
3300007347Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764649650 reassemblyHost-AssociatedOpen in IMG/M
3300007367Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 763820215 reassemblyHost-AssociatedOpen in IMG/M
3300007531Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764224817 reassemblyHost-AssociatedOpen in IMG/M
3300007638Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159915365 reassemblyHost-AssociatedOpen in IMG/M
3300007659Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 160158126 reassemblyHost-AssociatedOpen in IMG/M
3300007663Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765701615 reassemblyHost-AssociatedOpen in IMG/M
3300007803Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763435843 reassemblyHost-AssociatedOpen in IMG/M
3300007828Human attached/keratinized gingiva microbial communities from NIH, USA - visit 2, subject 763961826 reassemblyHost-AssociatedOpen in IMG/M
3300007938Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 158479027 reassemblyHost-AssociatedOpen in IMG/M
3300007940Human attached/keratinized gingiva microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300007978Human throat microbial communities from NIH, USA - visit 1, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300007994Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 160158126 reassemblyHost-AssociatedOpen in IMG/M
3300008061Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159571453 reassemblyHost-AssociatedOpen in IMG/M
3300008131Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159713063 reassemblyHost-AssociatedOpen in IMG/M
3300008143Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158499257 reassemblyHost-AssociatedOpen in IMG/M
3300008148Human throat microbial communities from NIH, USA - visit 2, subject 763961826 reassemblyHost-AssociatedOpen in IMG/M
3300008269Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300008270Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159369152 reassemblyHost-AssociatedOpen in IMG/M
3300008273Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 158883629 reassemblyHost-AssociatedOpen in IMG/M
3300008348Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159268001 reassemblyHost-AssociatedOpen in IMG/M
3300008415Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765013792 reassemblyHost-AssociatedOpen in IMG/M
3300008483Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764083206 reassemblyHost-AssociatedOpen in IMG/M
3300008506Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 159510762 reassemblyHost-AssociatedOpen in IMG/M
3300008524Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160319967 reassemblyHost-AssociatedOpen in IMG/M
3300008565Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158499257 reassemblyHost-AssociatedOpen in IMG/M
3300008581Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158944319 reassemblyHost-AssociatedOpen in IMG/M
3300008611Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 823052294 reassemblyHost-AssociatedOpen in IMG/M
3300008615Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 675950834 reassemblyHost-AssociatedOpen in IMG/M
3300008639Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764083206 reassemblyHost-AssociatedOpen in IMG/M
3300008679Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763577454 reassemblyHost-AssociatedOpen in IMG/M
3300008695Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764083206 replicate 1 reassemblyHost-AssociatedOpen in IMG/M
3300008715Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763577454 reassemblyHost-AssociatedOpen in IMG/M
3300008745Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764083206 replicate 2 reassemblyHost-AssociatedOpen in IMG/M
3300008754Human palatine tonsils microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300014038Human oral microbial communities from Los Angeles, CA, USA - S27-04-RHost-AssociatedOpen in IMG/M
3300014106Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_211Host-AssociatedOpen in IMG/M
3300014554Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_106Host-AssociatedOpen in IMG/M
7000000007Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159551223Host-AssociatedOpen in IMG/M
7000000025Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 159005010Host-AssociatedOpen in IMG/M
7000000086Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159227541Host-AssociatedOpen in IMG/M
7000000128Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 675950834Host-AssociatedOpen in IMG/M
7000000132Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158337416Host-AssociatedOpen in IMG/M
7000000140Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 550534656Host-AssociatedOpen in IMG/M
7000000156Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763901136 replicate 1Host-AssociatedOpen in IMG/M
7000000176Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764649650Host-AssociatedOpen in IMG/M
7000000195Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159814214Host-AssociatedOpen in IMG/M
7000000203Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159571453Host-AssociatedOpen in IMG/M
7000000205Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 158742018Host-AssociatedOpen in IMG/M
7000000207Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 158742018Host-AssociatedOpen in IMG/M
7000000208Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158479027Host-AssociatedOpen in IMG/M
7000000274Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 737052003Host-AssociatedOpen in IMG/M
7000000277Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159490532Host-AssociatedOpen in IMG/M
7000000285Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159005010Host-AssociatedOpen in IMG/M
7000000336Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764083206Host-AssociatedOpen in IMG/M
7000000349Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763759525Host-AssociatedOpen in IMG/M
7000000395Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764083206Host-AssociatedOpen in IMG/M
7000000404Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158499257Host-AssociatedOpen in IMG/M
7000000406Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159713063Host-AssociatedOpen in IMG/M
7000000437Human palatine tonsils microbial communities from NIH, USA - visit 1, subject 763496533Host-AssociatedOpen in IMG/M
7000000439Human saliva microbial communities from NIH, USA - visit 1, subject 763496533Host-AssociatedOpen in IMG/M
7000000461Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 604812005Host-AssociatedOpen in IMG/M
7000000519Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160178356Host-AssociatedOpen in IMG/M
7000000561Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763860675Host-AssociatedOpen in IMG/M
7000000576Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158499257Host-AssociatedOpen in IMG/M
7000000621Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159268001Host-AssociatedOpen in IMG/M
7000000666Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 370425937Host-AssociatedOpen in IMG/M
7000000676Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765013792Host-AssociatedOpen in IMG/M
7000000710Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159268001Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
kg300_013321102124908010Keratinized GingivaMNRRILSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKNAKRDSYSVYLNFLSDSEVEVSAYASKDPTASYYEQARYYYTVTDRIFTLKTQVDYELNPPIDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL
sp300_027829402124908012Subgingival PlaqueMNRRILSFCGLLLGLLFLVSSCKKDTPRLQLQLSSVELRQTVWNGTLEYKSAKRGSYSVYLNFLSDSEVEVSVYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANPGNPDREATLTLRKKL
sp300_016675702124908012Subgingival PlaqueLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL
Ga0099348_11027423300006243HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTYSDDVQVRYYYTITDRIFTLKAQVNRELHPQMDQDTWYLIRKEPSLLVFQANAGNPDREATLTLRKQL*
Ga0099369_10629613300006245HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKSAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0099374_100006453300006247HumanMNRRIFSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEHKNAKRDSYSVYLNFLSDSEVEVSGYDLKDPTYPRDVQVRYYYTITDRILTLKAQVNRELHPPMDQNTWYLIRKEPSLLVFQANAGNPDREATLTLRRKL*
Ga0099391_12750013300006250HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL*
Ga0099392_10674023300006251HumanMNRRIFSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKSAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0099365_100032923300006254HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0099353_100084343300006255HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLELSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL*
Ga0099518_11756223300006260HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTDSQVRYYYTITDGIFTLKAQVNREHHPQMDQDTWYLIRKEPSLLVFQANAGNPDREATLTLRKQL*
Ga0099556_11226413300006291HumanMNRRIFSFCGLLLGLLFLASSCKKDTPRLQLQLSSVELRQTVWNGTLEYKSAKRVSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEVTLTLRKKL*
Ga0099622_1000131623300006292HumanMNRRILSFCGLLLGLLFLASSCKKDTPRLQLQLSSVELRQTVWNGTLEYKSAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL*
Ga0099630_101261223300006297HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLELSSVELRQTVWNGTLEYKNAKYGPYSVYLSFVSDSIVEVSTFTTTDLTAAHDFKDLCSYAMDGRILTLRARDERYLNVSIDHNSWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0099617_13551113300006301HumanMNRRIFSFCGLLLGLLFLSSSCKKDTPLPPQLSEGELRQTVWNGTLEYKSAKRGSSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPDREATLTLRRKL*
Ga0099615_1000518143300006307HumanMNRRILSFCGLLLGLLFLVSSCKKDTPRLQLQLSSVELRQTVWNGTLEYKSAKRGSYSVYLNFLSDSEVEVSVYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANPGNPDREATLTLRKKL*
Ga0099623_102257423300006322HumanMNRRILSFCGLLLGLLFLASSCKKDTPRLRLSSVELRQTVWNGTLEYKSAKYGPYFVYLSFVSDSIVEVSTFATTDLTVAYDSKDLCSYTMDDRILTLRARDEPYLNVSIDRNSWYLIRKEPSLLVFQANAGNPAAEVTLTLRKKL*
Ga0099580_11196923300006328HumanMNRRILSFCGLLLGLLFLASSCKSKKDTPRLQLSSVELRQTVWYGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTDSQVRYYYTITDGIFTLKAQVNRELHPQMDQDIWYLIRKEPSLLVFQANAGNPDREATLTLRKKL*
Ga0099580_11790023300006328HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTWESKNAKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0100175_100299333300006458HumanMNRRILSFCGLLLGLLFLASSCKSKKDTPRLQLSSVELRQTAWYGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTDSQVRYYYTITDGIFTLKAQVNRELHPPMDQDTWYLIRKEPSLLVFQANAGNPDREATLTLRKQL*
Ga0101805_10074343300006742HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL*
Ga0102522_11661013300006898HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSLELRQTVWNGTLEYKSAKYGPYSVYLSFVSDSVVEVSTFTTTDLTAAHDLEAPCSYTMDDRILTLRTQGDLYLRVSIDRSSWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0102632_103639613300007107HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLELSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQDNRELHPSMDQNTWYLIRKEPSLLVFQANAGNP
Ga0102632_105162413300007107HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPD
Ga0102671_14056113300007121HumanILSFCGLLLGLLFLASSCKKDTPRLQLSSVELRQTVWNGTLEYKSAKYGPYSVYLSFVSDSVVEVSTFTTTDLTAAHDLEAPCSYTMDDRILTLRTQGDLYLRVSIDRSSWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0102683_11421723300007122HumanMNRRILSFCGLLLGLLFLASSCKKDTPRLQLSSVELRQTVWNGTLEYKSAKYGPYSVYLSFVSDSVVEVSTFTTTDLTAAHDLEAPCSYTMDDRILTLRTQGDLYLRVSIIDRSSWYLIRKEPSLLVFQANPGNPAAEATLTLRKKL*
Ga0102685_10224713300007124HumanMNRRILSFCGLLLGLLFLASSCKSKKDTPRLQLSSVELRQTAWYGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTDSQVRYYYTITDGIFTLKAQVNRELHPQMDQDTWYLIRKEPSLLVFQANAGNPDREATLTLRKQL*
Ga0102700_104453323300007125HumanMNRRILSFCGLLLGLLFLASNCKKDTPRLHLSSLELRQTVWNGTLEYKSAKYGSYSVYLSFVSDSVVEVSTSTTTDLTAAHDIQAPCSYTMDDRVLTLRTQGERYLYVSIDRNSWYLIRKEPSLLVFQANAGNPASEATLTLRKKL*
Ga0103277_100103143300007127HumanMNRRILSFCGLLLGLLFLASSCKKDTPRLRLSSVELRQTVWNGTLEYKNAKRDSYSVYLNFLSDSEVEVSAYASKDPTASYYEQARYYYTVTDRIFTLKAQVNRELRPPMDQNIWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0102715_103514923300007167HumanMNRRIFSFSGLLLGLLFLASSCKKDTPRLRLSSVELRQTVWNGTLEYKSAKYGPYFVYLSFVSDSIVEVSTFATTDLTVAYDSKDLCSYTMDDRILTLRARDEPYLNVSIDRNSWYLIRKEPSLLVFQANAGNPAAEVTLTLRKKL*
Ga0103269_10010813300007194HumanMNRRILSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKSAKRGSSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0104752_11379613300007284HumanMNRRILSFCGLLLGLLFLASSCKSKKDTPRLQLSSVELKQTVWNGTLEYKDASRLTYSVYLSFVSDSTVEVSTFATTDPTAAFDSKDLCSYTMDDRILTLRTRGALPLNVSIDRNSWYLIRKEPSLLVFQANAGNPAAEATMTLHRKL*
Ga0102636_10027343300007285HumanMNRRILSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKNAKRDSYSVYLNFLSDSEVEVSAYASKDPTASYYEQARYYYTVTDRIFTLKTQVDYELNPPIDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0104873_10068353300007287HumanMNRRILSFCGLLLGLLFLASSCKSKKDTPRLQLSSVELRQTAWYGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTDSQVRYYYTITDGIFTLKAQVNRELHPQMDQDTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0104867_100698513300007295HumanLGLLFLASSCKNKKDTPRLELSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL*
Ga0104867_102785413300007295HumanMNRRIFSFCGLLLGLLFLSSSCKKDTPLPPQLSEGELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0104928_11726313300007309HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTWESKNAKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRTEPS
Ga0104971_12508013300007339HumanLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKSAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL*
Ga0104340_10111413300007347HumanLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNVKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL*
Ga0104973_10068813300007367HumanLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0105502_103232913300007531HumanMNRRILSFCGLLLGLLFLVSSCKKDTPRLQLQLSSVELRQTVWNGTLEYKSAKRGSYSVYLNFLSDSEVEVSVYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0105526_100133183300007638HumanMNRRILSFCGLLLGLLFLASSCKKDTPRLHLSSLELRQTVWNGTLEYKSAKYGPYSVYLSFVSDSIVEVSTFTTTDLTAAHDSEAPCRYTMDDRILTLRTQGDLYLRVSIDRSSWYLIRKEPSLLVFQANAGNPAEEATLTLRKKL*
Ga0105537_10063113300007659HumanLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL*
Ga0105541_102526413300007663HumanLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKSAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANA
Ga0105780_10137443300007803HumanMNRRIFSFSGLLLGLLFLASSCKKDTPRLRLSSVELRQTVWNGTLEYKSAKYGPYFVYLSFVSDSIVEVSTFATTDLTVAYDSKDLCSYTMDDRILTLRARDEPYLNVSIDRNSWYLIRKEPSLLVFQANAGNPASEATLTLRKKL*
Ga0105780_11932913300007803HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNAKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRIFTLKAQVNRELRPPMDQNIWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0105961_10180823300007828HumanLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL*
Ga0114251_10923713300007938HumanLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0114257_10032043300007940HumanMNRRIFTWCGLLAGLLLFAYSCKKDTPRLQLSSVELKQTVWNGTLEYKDASRLTYSVYLSFVSDSTVEVSTFATTDPTAAFDSKDLCSYTMDDRILTLRTRGALPLNVSIDRNSWYLIRKEPSLLVFQANAGNPAAEATMTLHKKL*
Ga0111424_13677213300007978HumanLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0113878_10301523300007994HumanLGLLFLASSCKNKKATPRLEFSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL*
Ga0111056_11508213300008061HumanMNRRIFSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKSAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQ
Ga0111081_10353623300008131HumanMNRRIFSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTWESKNAKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0114287_13268013300008143HumanMNRRILSFCGLLLGLLFLASSCKSKKDTPRLQLSSVELRQTAWYGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTDSQVRYYYTITDGIFTLKAQVNREHHPQMDQDTWYLIRKEPSLLVFQANAGNPDREATLTLRKQL*
Ga0114323_102408513300008148HumanGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0114154_11436613300008269HumanLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0114159_12003413300008270HumanMNRRIFSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKSAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEA
Ga0114250_10267813300008273HumanSFCGLLLGLLFLASSCKKDTPRLRLSSVELRQTVWNGTLEYKSAKYGPYFVYLSFVSDSIVEVSTFATTDLTVAYDSKDLCSYTMDDRILTLRARDEPYLNVSIDRNSWYLIRKEPSLLVFQANAGNPAAEVTLTLRKKL*
Ga0115412_10255213300008348HumanMNRRIFSFCGLLLGLLFLASSCKNKKDTPRLELSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDSYAVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFLANAGNPDREATLTLRKKL*
Ga0115225_10024143300008415HumanMNRRILSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEHKNAKRDSYSVYLNFLSDSEVEVSGYDLKDPTYPRDVQVRYYYTITDRILTLKAQVNRELHPPMDQNTWYLIRKEPSLLVFQANAGNPDREATLTLRRKL*
Ga0105906_101431713300008483HumanMNRRIFALCGLLAGFLLFAYSCKKDTPRLQLSSGELKQTVWNGTLEYKDASRLTYSVYLSFVSDSIVEVSTFATTDPTAAFDSKYPCSYTMDDRILTLRTRGVLPLNVSIDRNSWYLIRKEPSLLVFQANAGNPAAEATMTLHKKL*
Ga0115176_105786713300008506HumanNRRILSFCGLLLGLLFLASSCKNKKDTPRLELSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSGSEVEVSAYDSKDPTDSYAVQADCFYTITDRIFTLKIQGDRELHPSMDQNAWYLIRKEPSLLVFLANAGNPDREATLTLRKKL*
Ga0111046_10390233300008524HumanLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0111046_12990713300008524HumanTMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNAKRDSYSVYLNFLSDSEVEVSAYASKDPTASYYEQARYYYTVTDRIFTLKTQVDYELNPPIDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0111061_100015743300008565HumanLGLLFLASSCKNKKDTPRLELSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSGSEVEVSAYDSKDPTDSYAVQADCFYTITDRIFTLKIQGDRELHPSMDQNAWYLIRKEPSLLVFLANAGNPDREATLTLRKKL*
Ga0111080_13686313300008581HumanMNRRILSFCGLLLGLLFLASSCKKDTPRLQLSSVELRQTVWNGTLEYKSAKYGPYSVYLSFVSDSVVEVSTFTTTDLTAAHDLEAPCSYTMDDRILTLRTQGDLYLRVSIDRSSWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL*
Ga0111137_102705913300008611HumanMNRRILSFCGLLLGLLSLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKSAKRGSSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYL
Ga0111231_100618823300008615HumanMNRRIFSFSGLLLGLLFLASSCKKDTPRLRLSSVELRQTVWNGTLEYKSAKYGSYSVYLSFVSDSVVEVSTSTTTDLTAAHDIQAPCSYTMDDRILTLRARDEPYLNVSIDRNSWYLIRKEPSLLVFQANAGNPDREATLTLRKKL*
Ga0115685_102672613300008639HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNAKRVSYSVYLNFLSDSEVEVIADDWIDPTDSQVRYYYTITDGIFTLKAQVNRELHPQMDQDTWYLIRKEPSLLVFQANAGNPDREATLTLHKQL*
Ga0115430_104956023300008679HumanLEYKSAKYGPYFVYLSFVSDSIVEVSTFATTDLTVAYDSKDLCSYTMDDRILTLRARDEPYLNVSIDRNSWYLIRKEPSLLVFQANAGNPAAEVTLTLRKKL*
Ga0113557_13690813300008695HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVGVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0115609_104100813300008715HumanMNRRILSFCGLLLGLLFLASSCKKDTPRLQLSSVELRQTVWNGTLEYKSAKYGPYSVYLSFVSDSVVEVSTFTTTDLTAAHDLEAPCSYTMDDRILTLRTQGERYLYVSIDRSTWYLIRKEPSLLVFQANAG
Ga0115673_104930713300008745HumanRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVGVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0114089_13184013300008754HumanMNRRILSFCGLLLGLLFLASSCKKDTPRLRLSSVELRQTVWNGTLEYKSAKYGPYSVYLSFVSDSVVEVSTFTTTDLTGAHDLEAPCSYTMDDRILTLRTQGERYLYVSIDRSTWYLIRK
Ga0119819_109664413300014038Human OralTPRLRLSSVELRQTVWNGTLEYKSAKYGPYSVYLSFVSDSVVEVSTSTTTDLTAAHDIQAPCSYTMDDRVLTLRTQGERYLYVSIDRNSWYLIRKEPSLLVFQANAGNPASEATLTLRKKL*
Ga0134353_10273023300014106Human OralMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELGQTVWNGTWESKNAKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*
Ga0134345_10103413300014554Human OralMNRRIFSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTAWYGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTDSQVRYYYTITDGIFTLKAQVNRELHPQMDQDTWYLIRKEPSLLVFQANAGNPDREATLTLRKQL*
C3743270__gene_2128377000000007HumanFLASSCKNKKDTPRLELSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL
SRS023617_Baylor_scaffold_74304__gene_1107277000000025HumanMNRRIFSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKSAKRVSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL
SRS049147_LANL_scaffold_61195__gene_675577000000086HumanMNRRIFSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKSAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANA
SRS050244_LANL_scaffold_43035__gene_510137000000128HumanFCGLLLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL
SRS012285_Baylor_scaffold_5238__gene_60847000000132HumanMNRRILSFCGLLLGLLFLASSCKKDTPRLRLSSVELRQTVWNGTLEYKSAKYGPYFVYLSFVSDSIVEVSTFATTDLTVAYDSKDLCSYTMDDRILTLRARDEPYLNVSIDRNSWYLIRKEPSLLVFQANAGNPAAEVTLTLRKKL
C2845143__gene_1519327000000140HumanGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKSAKRGSSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL
C2452637__gene_1508167000000156HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL
C2228983__gene_1301497000000176HumanLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNVKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL
SRS017209_Baylor_scaffold_1252__gene_16997000000195HumanLLLGLLFLSSSCKKDTPLPPQLSEGELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL
SRS024441_LANL_scaffold_54814__gene_724527000000203HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEHKNAKRDSYSVYLNFLSDSEVEVSAYDLKDPTHSRDVQVRYYYTITDRIFTLKAQVNYELHPQMDQDTWYLIRKEPSLLVFQANAGNPDREATLTLRKKL
SRS011247_Baylor_scaffold_13865__gene_128547000000205HumanMNRRILSFCGLLLGLLFLASSCKSKKDTPRLQLSSVELRQTAWYGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTDSQVRYYYTITDGIFTLKAQVNRELHPQMDQDTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL
SRS011243_Baylor_scaffold_42417__gene_509267000000207HumanLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL
SRS011126_Baylor_scaffold_66706__gene_808897000000208HumanLQLSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL
SRS052876_LANL_scaffold_51901__gene_667047000000274HumanLGLLFLASSCKNKKDTPRLELSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKKL
C1114912__gene_207557000000277HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKSAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKKL
SRS023595_Baylor_scaffold_16918__gene_145577000000285HumanMNRRIFSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEHKNAKRDSYSVYLNFLSDSEVEVSGYDLKDPTYPRDVQVRYYYTITDRILTLKAQVNRELHPPMDQNTWYLIRKEPSLLVFQANAGNPDREATLTLRRKL
SRS019073_WUGC_scaffold_14308__gene_108907000000336HumanTPRLQLSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRKK
C3249457__gene_1313177000000349HumanLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQANAGNPDREATLTLRK
SRS019077_WUGC_scaffold_2293__gene_20147000000395HumanLGLLFLASSCKNKKDTPRLEFSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTASYIVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFQAN
C4344126__gene_1704947000000404HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLELSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSGSEVEVSAYDSKDPTDSYAVQADCFYTITDRIFTLKIQGDRELHPSMDQNAWYLIRKEPSLLVFLANAGNPDREATLTLRKKL
SRS024381_LANL_scaffold_71051__gene_965617000000406HumanMNRRIFSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTWESKNAKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL
SRS013947_WUGC_scaffold_11274__gene_125677000000437HumanCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL
SRS013942_WUGC_scaffold_6862__gene_45767000000439HumanLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL
SRS045127_LANL_scaffold_37032__gene_450947000000461HumanTLEYKSAKYGPYFVYLSFVSDSIVEVSTFATTDLTVAYDSKDLCSYTMDDRILTLRARDEPYLNVSIDRNSWYLIRKEPSLLVFQANAGNPAAEVTLTLRKKL
C3930440__gene_1507867000000519HumanLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL
SRS057355_LANL_scaffold_8101__gene_33437000000561HumanLFLASSCKSKKDTPRLQLSSVELRQTVWYGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTDSQVRYYYTITDGIFTLKAQVNRELHPQMDQDTWYLIRKEPSLLVFQANAGNPDREATLTLRKKL
C4051030__gene_1713137000000576HumanMNRRILSFCGLLLGLLFLASSCKSKKDTPRLQLSSVELRQTAWYGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTDSQVRYYYTITDGIFTLKAQVNREHHPQMDQDTWYLIRKEPSLLVFQANAGNPDREATLTLRKQL
C1749332__gene_333227000000621HumanMNRRIFSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKK
C2913772__gene_1625537000000666HumanMNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTYSDDVQVRYYYTITDRIFTLKAQVNRELHPQMDQDTWYLIRKEPSLLVFQANAGNPDREATLTLRKQL
C3755057__gene_2129837000000676HumanMNRRILSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEHKNAKRDSYSVYLNFLSDSEVEVSGYDLKDPTYPRDVQVRYYYTITDRILTLKAQVNRELHPPMDQNTWYLIRKEPSLLVFQANAGNPDREATLTLRRKL
C2192944__gene_403957000000710HumanMNRRIFSFCGLLLGLLFLASSCKNKKDTPRLELSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDSYAVQADCFYTITDRIFTLKTQGDRELHPSMDQNAWYLIRKEPSLLVFLANAGNPDREATLTLRKKL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.