3300014106: Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_211

Overview

Basic Information

• IMG/M Taxon OID: 3300014106
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121296 | Gp0151525 | Ga0134353
• Sample Name: Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_211
• Sequencing Status: Permanent Draft
• Sequencing Center: The George Washington University (GWU)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 25980866
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal secretion

Location Information

• Location: USA: Maryland
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040149	Metagenome	162	N
F090517	Metagenome	108	N
F103431	Metagenome	101	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0134353_100661	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279	2559
Ga0134353_101542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria	1686
Ga0134353_102730	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii	1233

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134353_100661	Ga0134353_1006612	F040149	VTDEGAKELRWEVLIEEQGIPVLFVEVEAWYDGRVSSSEILRSVGIALEREPRLAPVWGHDSEDAIDYFIYDVLVPEGHALTAVRERETVVAQLLNIHRYVYYP*
Ga0134353_101542	Ga0134353_1015421	F103431	FNTGLMIDFDALIVGMLVFIQLFLQGIAWRVAIAHFFHAERGNAAAAAFDGAFGENIADCHTEDNNDKNAESKEEGFHVYIPEG*
Ga0134353_102730	Ga0134353_1027302	F090517	MNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELGQTVWNGTWESKNAKRDSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL*