NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006243

3300006243: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 370425937



Overview

Basic Information
IMG/M Taxon OID3300006243 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052782 | Ga0099348
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 2, subject 370425937
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size52639523
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2791
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051213Metagenome144N
F067846Metagenome125Y
F090517Metagenome108N
F099454Metagenome103N
F103436Metagenome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0099348_100808All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2797709Open in IMG/M
Ga0099348_102087All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus3708Open in IMG/M
Ga0099348_110274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii875Open in IMG/M
Ga0099348_114252All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas677Open in IMG/M
Ga0099348_116555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus605Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0099348_100808Ga0099348_1008081F051213MKASKLLWTVVMALTFVLTSCDPFSQNEPTIEGDRYKYFDSSAQRQSFRVVNGSGKQYNHKVDWHIIGILEENSSTYLTKKVDTLSNGDFRISYDWVTFTVKENKSVIDVEVQKNETGKDRSVFFATSNSYKQAYLPNMIVTQRAK*
Ga0099348_102087Ga0099348_1020874F067846METMQRQWEMASFTAYDKAQEQYDAYGRAIEMEIESIKEDIANCDDDVICVFREKMLDYDEVINAFDDDTFNDDEFIKAVALGTDYEEIRIKILVAMAEDRLEQLEEDYRKGYILND*
Ga0099348_110274Ga0099348_1102742F090517MNRRILSFCGLLLGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNPKRDNYSVYLNFLSDSEVEVIADDWIDPTYSDDVQVRYYYTITDRIFTLKAQVNRELHPQMDQDTWYLIRKEPSLLVFQANAGNPDREATLTLRKQL*
Ga0099348_114252Ga0099348_1142521F099454KALAVVLRDFSPTRAGVFLQCSQRHLVETERIYLYLVSKRTHKPKTHSGIKTLMKASKLLWAVVMAFTFVFTSCDRLTDEPTLEDRGYYKYFDSTAQHKSFRVVTASGKPYNHKIDWHIIGIRDSKSDTYLTKKVDTLSNGDLKISYDWISFTVREKKSVIDVEVQKNETGEDRSVKFVAQDNHKGLASPSMKVIQQAK*
Ga0099348_116555Ga0099348_1165551F103436SEIFDSLGDWVMKCDLKYSKSDALYKVKLAQCLWGEGEYIEALHLLDENEVFFEKSDWPYYALAIEILKARKHKFFNE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.