| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000439 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052989 | Ga0030207 |
| Sample Name | Human saliva microbial communities from NIH, USA - visit 1, subject 763496533 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 18585399 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Pseudoprevotella → Pseudoprevotella muciniphila | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Saliva → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043235 | Metagenome | 156 | N |
| F068942 | Metagenome | 124 | N |
| F071328 | Metagenome | 122 | N |
| F090517 | Metagenome | 108 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C1228487 | Not Available | 602 | Open in IMG/M |
| C1230290 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Pseudoprevotella → Pseudoprevotella muciniphila | 636 | Open in IMG/M |
| C1241615 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1296 | Open in IMG/M |
| SRS013942_WUGC_scaffold_6862 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii | 771 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C1228487 | C1228487__gene_31741 | F071328 | MKWEFILEGEYIVEFVKLCKHLVLERTIDPKKHQAAAIYLRYSLQLLLKKRRAIRRLGVEKEYVSAILRQYGIHYREYGDNEHRVFFLDTGINIYFSKHHQSSIYIIQRI |
| C1230290 | C1230290__gene_32744 | F068942 | MIRKILSLPTLALCLTLGSALFAGCNEDYIKNTETKVRWSNVKNPKYGDPINITLKAEGETFTTVGDHSWISFSNDASTLDTFTRHRFSEVDKDTAYYKDIVIYLTRNKREETTTLKLVAPPNRTQQPKQF |
| C1241615 | C1241615__gene_39792 | F043235 | MDEVVPSDEGHLLIDLCDDDPRSLCGRLGIVTRYPEGAIALFIGLAHRDQCDIDRIDTIPKEVWEFMEVTREIVDSLIQVSGAAILVKEVKDGMYMPHHLWAEVPRLGKVQHVEDFHVREALAIIVEGFGEAAGGCHSMAKDQEVPALYYRSHGFEGGRSMASNVLLPGSAH |
| SRS013942_WUGC_scaffold_6862 | SRS013942_WUGC_scaffold_6862__gene_4576 | F090517 | LGLLFLASSCKNKKDTPRLQLSSVELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSGYDLKDPTYSRDLQVRYYYTITDRILTLKAQVNRELRPPMDQNTWYLIRKEPSLLVFQANAGNPDLEATLTLRKKL |
| ⦗Top⦘ |