7000000621: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159268001

Overview

Basic Information

• IMG/M Taxon OID: 7000000621
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0053195 | Ga0027924
• Sample Name: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159268001
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 21373229
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii	1
All Organisms → cellular organisms → Bacteria	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: National Institutes of Health, USA
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040149	Metagenome	162	N
F043235	Metagenome	156	N
F090517	Metagenome	108	N

Associated Scaffolds

Scaffold	Taxonomy	Length
C1749332	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii	553
C1758406	All Organisms → cellular organisms → Bacteria	740
C1760036	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	800

Sequences

Scaffold ID	Protein ID	Family	Sequence
C1749332	C1749332__gene_33322	F090517	MNRRIFSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKK
C1758406	C1758406__gene_38899	F040149	VADEGAEELRWKVLIKEQGIPVLFVEVEAWYDGRVSSSEILRSVGIALEREPQLTPVWSHDSEDAIHDFIYDTSVPKGHTLTAVRERETVVAQLLNIHRYVYYP
C1760036	C1760036__gene_39984	F043235	GIGDRPDTDLKRISVVDEFGTQLTDALLDRPDRSKRKLHQGAVNGDDIVQLRHMDEVVPSDEGHLLIDLCDDDPRSLCGGLGIVTRYPEGAIALFIGLAHRDQCDIDRIDTIPKEVWEFMEVTREIVDTLIQVSGAAILVKEVKDGMYMPHHLWAEVPRLGKVQHVEGFHVREALAIIVEGFGETAGGCHSMAKDQEVPALYCRSHGFKGGRSMASNVLLPGSAH