NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F098763

Metagenome Family F098763

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098763
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 52 residues
Representative Sequence MDRRTSLRVLSTALYLATKLFEAVVRTTISYDSSDEVEGKGGMNAIPTAVDE
Number of Associated Samples 94
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.80 %
% of genes near scaffold ends (potentially truncated) 12.62 %
% of genes from short scaffolds (< 2000 bps) 37.86 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human
(40.777 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
(95.146 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.15%    β-sheet: 0.00%    Coil/Unstructured: 53.85%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF09912DUF2141 15.53
PF07715Plug 8.74
PF00593TonB_dep_Rec 5.83
PF03446NAD_binding_2 1.94
PF00574CLP_protease 1.94
PF05746DALR_1 0.97
PF01039Carboxyl_trans 0.97
PF07517SecA_DEAD 0.97
PF01182Glucosamine_iso 0.97
PF02781G6PD_C 0.97
PF07690MFS_1 0.97
PF02075RuvC 0.97
PF02779Transket_pyr 0.97
PF04551GcpE 0.97
PF07478Dala_Dala_lig_C 0.97
PF12081GldM_N 0.97
PF03485Arg_tRNA_synt_N 0.97
PF01253SUI1 0.97
PF02880PGM_PMM_III 0.97
PF07075DUF1343 0.97
PF13589HATPase_c_3 0.97
PF13328HD_4 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 3.88
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 3.88
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.94
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.94
COG0751Glycyl-tRNA synthetase, beta subunitTranslation, ribosomal structure and biogenesis [J] 0.97
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.97
COG3876Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 familyCell wall/membrane/envelope biogenesis [M] 0.97
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 0.97
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.97
COG08214-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpELipid transport and metabolism [I] 0.97
COG0817Holliday junction resolvasome RuvABC endonuclease subunit RuvCReplication, recombination and repair [L] 0.97
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.97
COG0653Preprotein translocase subunit SecA (ATPase, RNA helicase)Intracellular trafficking, secretion, and vesicular transport [U] 0.97
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 0.97
COG03636-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminaseCarbohydrate transport and metabolism [G] 0.97
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 0.97
COG0023Translation initiation factor 1 (eIF-1/SUI1)Translation, ribosomal structure and biogenesis [J] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006996|Ga0102724_103638All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1134Open in IMG/M
3300007204|Ga0103275_102614All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2796045Open in IMG/M
3300007278|Ga0104339_101582All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1663Open in IMG/M
3300007284|Ga0104752_104880All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2137Open in IMG/M
3300007300|Ga0104843_103328All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2796916Open in IMG/M
3300007318|Ga0104925_101456All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2796928Open in IMG/M
3300007320|Ga0104940_1005869All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2794860Open in IMG/M
3300007335|Ga0104969_1056633All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas697Open in IMG/M
3300007339|Ga0104971_100354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27922632Open in IMG/M
3300007355|Ga0104762_1000710All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27912908Open in IMG/M
3300007368|Ga0104977_1000632All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27922320Open in IMG/M
3300007497|Ga0104979_101871All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2794368Open in IMG/M
3300007531|Ga0105502_1004990All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2796606Open in IMG/M
3300007531|Ga0105502_1050643All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas671Open in IMG/M
3300007638|Ga0105526_1000039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279146633Open in IMG/M
3300007659|Ga0105537_100001All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279173949Open in IMG/M
3300007662|Ga0105539_102479All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2793691Open in IMG/M
3300007663|Ga0105541_1015660All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1215Open in IMG/M
3300007728|Ga0105754_1000772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27910993Open in IMG/M
3300007746|Ga0105776_1000128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27935509Open in IMG/M
3300007803|Ga0105780_108417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2792445Open in IMG/M
3300007967|Ga0105958_101271All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2794414Open in IMG/M
3300007971|Ga0114094_1000037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27919102Open in IMG/M
3300007994|Ga0113878_133194All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas719Open in IMG/M
3300007997|Ga0111053_100024All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279143753Open in IMG/M
3300008061|Ga0111056_104504All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2791341Open in IMG/M
3300008074|Ga0114852_106784All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1653Open in IMG/M
3300008080|Ga0105957_100739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27923720Open in IMG/M
3300008125|Ga0114856_1000136All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27964181Open in IMG/M
3300008127|Ga0114846_102176All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2793080Open in IMG/M
3300008128|Ga0114847_101274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27910346Open in IMG/M
3300008128|Ga0114847_101931All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2797571Open in IMG/M
3300008133|Ga0111365_146510All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas502Open in IMG/M
3300008140|Ga0114165_1001195All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27917248Open in IMG/M
3300008147|Ga0114367_100002All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279342074Open in IMG/M
3300008155|Ga0114001_100835All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27924219Open in IMG/M
3300008155|Ga0114001_104967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2795506Open in IMG/M
3300008161|Ga0110913_1001697All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27911000Open in IMG/M
3300008331|Ga0114894_103151All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2792676Open in IMG/M
3300008334|Ga0115372_1015243All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp.1462Open in IMG/M
3300008347|Ga0115411_1034909All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae594Open in IMG/M
3300008406|Ga0115224_1000114All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27985691Open in IMG/M
3300008413|Ga0115229_116650All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas635Open in IMG/M
3300008415|Ga0115225_105077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2792103Open in IMG/M
3300008436|Ga0115418_103831All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2793486Open in IMG/M
3300008436|Ga0115418_106940All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2792143Open in IMG/M
3300008474|Ga0115375_100562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27910499Open in IMG/M
3300008486|Ga0115196_1000793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27924696Open in IMG/M
3300008504|Ga0114860_100007All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279371140Open in IMG/M
3300008514|Ga0111023_100831All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27916100Open in IMG/M
3300008518|Ga0115191_100001All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279553250Open in IMG/M
3300008541|Ga0111054_100005All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279356710Open in IMG/M
3300008575|Ga0111079_103787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2797011Open in IMG/M
3300008575|Ga0111079_122569All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp.1118Open in IMG/M
3300008615|Ga0111231_1021342All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas922Open in IMG/M
3300008643|Ga0111423_114390All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1001Open in IMG/M
3300008660|Ga0111492_101478All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2797825Open in IMG/M
3300008695|Ga0113557_107540All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2793445Open in IMG/M
3300008695|Ga0113557_109329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2792831Open in IMG/M
3300008748|Ga0114085_100751All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27918950Open in IMG/M
3300008748|Ga0114085_111114All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp.2080Open in IMG/M
3300008749|Ga0115681_106527All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp.1402Open in IMG/M
3300011986|Ga0119795_1000072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27986690Open in IMG/M
3300014137|Ga0134350_1000313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27917547Open in IMG/M
3300014140|Ga0134344_1000061All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27930534Open in IMG/M
3300014554|Ga0134345_103551All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 2794449Open in IMG/M
3300014815|Ga0119815_1000834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 27924507Open in IMG/M
7000000005|SRS022536_LANL_scaffold_124411All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1493Open in IMG/M
7000000029|SRS042131_WUGC_scaffold_1367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas2106Open in IMG/M
7000000029|SRS042131_WUGC_scaffold_46931All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1453Open in IMG/M
7000000042|SRS023835_Baylor_scaffold_30478All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1317Open in IMG/M
7000000058|C2837855All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae687Open in IMG/M
7000000061|SRS014888_WUGC_scaffold_6531All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1051Open in IMG/M
7000000073|SRS021496_Baylor_scaffold_36952All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas805Open in IMG/M
7000000099|SRS055426_LANL_scaffold_48409All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae622Open in IMG/M
7000000109|SRS011306_Baylor_scaffold_57155All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas564Open in IMG/M
7000000125|SRS015941_WUGC_scaffold_12936All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1341Open in IMG/M
7000000126|C1787042All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas716Open in IMG/M
7000000149|SRS013881_WUGC_scaffold_6283All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2195Open in IMG/M
7000000182|C2094736All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas2783Open in IMG/M
7000000228|SRS022602_Baylor_scaffold_121503All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1970Open in IMG/M
7000000240|SRS015762_WUGC_scaffold_25647All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas517Open in IMG/M
7000000244|SRS016575_Baylor_scaffold_224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales19654Open in IMG/M
7000000253|SRS054569_LANL_scaffold_25570All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2924Open in IMG/M
7000000255|SRS065335_LANL_scaffold_5343All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas559Open in IMG/M
7000000288|SRS024087_LANL_scaffold_72976All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1436Open in IMG/M
7000000316|SRS017511_Baylor_scaffold_95824All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae3142Open in IMG/M
7000000371|C5265137All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas509Open in IMG/M
7000000396|SRS049268_LANL_scaffold_31090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae3679Open in IMG/M
7000000432|SRS063193_LANL_scaffold_7826All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas562Open in IMG/M
7000000436|SRS015644_WUGC_scaffold_47957All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2219Open in IMG/M
7000000440|SRS015797_WUGC_scaffold_23927All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas517Open in IMG/M
7000000457|SRS024447_LANL_scaffold_6225All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1423Open in IMG/M
7000000534|C4342009All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas588Open in IMG/M
7000000563|C2593508All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas701Open in IMG/M
7000000583|SRS019974_Baylor_scaffold_156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae2180Open in IMG/M
7000000599|SRS019022_WUGC_scaffold_29076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales36982Open in IMG/M
7000000622|SRS077736_LANL_scaffold_37853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales21830Open in IMG/M
7000000631|SRS050029_WUGC_scaffold_6986All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales5942Open in IMG/M
7000000670|C4880171All Organisms → cellular organisms → Bacteria5133Open in IMG/M
7000000676|C3680823All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas562Open in IMG/M
7000000676|SRS018665_WUGC_scaffold_59418All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1018Open in IMG/M
7000000686|C1769828All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas1303Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
HumanHost-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human40.78%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human32.04%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human19.42%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral2.91%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral1.94%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human1.94%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Saliva → Human0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006996Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 370425937Host-AssociatedOpen in IMG/M
3300007204Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763961826Host-AssociatedOpen in IMG/M
3300007278Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160319967 reassemblyHost-AssociatedOpen in IMG/M
3300007284Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159490532 reassemblyHost-AssociatedOpen in IMG/M
3300007300Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160603188 reassemblyHost-AssociatedOpen in IMG/M
3300007318Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 158742018 reassemblyHost-AssociatedOpen in IMG/M
3300007320Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158479027 reassemblyHost-AssociatedOpen in IMG/M
3300007335Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763759525 reassemblyHost-AssociatedOpen in IMG/M
3300007339Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763820215 reassemblyHost-AssociatedOpen in IMG/M
3300007355Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765640925 reassemblyHost-AssociatedOpen in IMG/M
3300007368Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158499257 reassemblyHost-AssociatedOpen in IMG/M
3300007497Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 404239096 reassemblyHost-AssociatedOpen in IMG/M
3300007531Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764224817 reassemblyHost-AssociatedOpen in IMG/M
3300007638Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159915365 reassemblyHost-AssociatedOpen in IMG/M
3300007659Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 160158126 reassemblyHost-AssociatedOpen in IMG/M
3300007662Human throat microbial communities from NIH, USA - visit 2, subject 765560005 reassemblyHost-AssociatedOpen in IMG/M
3300007663Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765701615 reassemblyHost-AssociatedOpen in IMG/M
3300007728Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 686765762 reassemblyHost-AssociatedOpen in IMG/M
3300007746Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160502038 reassemblyHost-AssociatedOpen in IMG/M
3300007803Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763435843 reassemblyHost-AssociatedOpen in IMG/M
3300007967Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160582958 reassemblyHost-AssociatedOpen in IMG/M
3300007971Human saliva microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300007994Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 160158126 reassemblyHost-AssociatedOpen in IMG/M
3300007997Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764083206 reassemblyHost-AssociatedOpen in IMG/M
3300008061Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159571453 reassemblyHost-AssociatedOpen in IMG/M
3300008074Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764143897 reassemblyHost-AssociatedOpen in IMG/M
3300008080Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763759525 reassemblyHost-AssociatedOpen in IMG/M
3300008125Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 763536994 reassemblyHost-AssociatedOpen in IMG/M
3300008127Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765337473 reassemblyHost-AssociatedOpen in IMG/M
3300008128Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159713063 reassemblyHost-AssociatedOpen in IMG/M
3300008133Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763840445 reassemblyHost-AssociatedOpen in IMG/M
3300008140Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300008147Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763961826 replicate 1 reassemblyHost-AssociatedOpen in IMG/M
3300008155Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 370425937 reassemblyHost-AssociatedOpen in IMG/M
3300008161Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 706846339 reassemblyHost-AssociatedOpen in IMG/M
3300008331Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764224817 reassemblyHost-AssociatedOpen in IMG/M
3300008334Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765560005 reassemblyHost-AssociatedOpen in IMG/M
3300008347Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764892411 reassemblyHost-AssociatedOpen in IMG/M
3300008406Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765701615 reassemblyHost-AssociatedOpen in IMG/M
3300008413Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765620695 reassemblyHost-AssociatedOpen in IMG/M
3300008415Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765013792 reassemblyHost-AssociatedOpen in IMG/M
3300008436Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 370425937 reassemblyHost-AssociatedOpen in IMG/M
3300008474Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 158944319 reassemblyHost-AssociatedOpen in IMG/M
3300008486Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160158126 reassemblyHost-AssociatedOpen in IMG/M
3300008504Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 159753524 reassemblyHost-AssociatedOpen in IMG/M
3300008514Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160765029 reassemblyHost-AssociatedOpen in IMG/M
3300008518Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764508039 reassemblyHost-AssociatedOpen in IMG/M
3300008541Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 604812005 reassemblyHost-AssociatedOpen in IMG/M
3300008575Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764083206 reassemblyHost-AssociatedOpen in IMG/M
3300008615Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 675950834 reassemblyHost-AssociatedOpen in IMG/M
3300008643Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 706846339 reassemblyHost-AssociatedOpen in IMG/M
3300008660Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 604812005 reassemblyHost-AssociatedOpen in IMG/M
3300008695Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764083206 replicate 1 reassemblyHost-AssociatedOpen in IMG/M
3300008748Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160178356 reassemblyHost-AssociatedOpen in IMG/M
3300008749Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 763759525 reassemblyHost-AssociatedOpen in IMG/M
3300011986Human oral microbial communities from Los Angeles, CA, USA - S12-03-RHost-AssociatedOpen in IMG/M
3300014137Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_208Host-AssociatedOpen in IMG/M
3300014140Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_104Host-AssociatedOpen in IMG/M
3300014554Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_106Host-AssociatedOpen in IMG/M
3300014815Human oral microbial communities from Los Angeles, CA, USA - S21-03-RHost-AssociatedOpen in IMG/M
7000000005Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 809635352Host-AssociatedOpen in IMG/M
7000000029Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 764487809Host-AssociatedOpen in IMG/M
7000000042Human tongue dorsum microbial communities from NIH, USA - visit 2 of subject 158883629Host-AssociatedOpen in IMG/M
7000000058Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764062976Host-AssociatedOpen in IMG/M
7000000061Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763860675Host-AssociatedOpen in IMG/M
7000000073Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158479027Host-AssociatedOpen in IMG/M
7000000099Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 604812005Host-AssociatedOpen in IMG/M
7000000109Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 158944319Host-AssociatedOpen in IMG/M
7000000125Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764325968Host-AssociatedOpen in IMG/M
7000000126Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763982056Host-AssociatedOpen in IMG/M
7000000149Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 763435843Host-AssociatedOpen in IMG/M
7000000182Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765640925Host-AssociatedOpen in IMG/M
7000000228Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158499257Host-AssociatedOpen in IMG/M
7000000240Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764224817Host-AssociatedOpen in IMG/M
7000000244Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159915365Host-AssociatedOpen in IMG/M
7000000253Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 160158126Host-AssociatedOpen in IMG/M
7000000255Human throat microbial communities from NIH, USA - visit 2, subject 765560005Host-AssociatedOpen in IMG/M
7000000288Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159510762Host-AssociatedOpen in IMG/M
7000000316Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160502038Host-AssociatedOpen in IMG/M
7000000371Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159814214Host-AssociatedOpen in IMG/M
7000000396Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 604812005Host-AssociatedOpen in IMG/M
7000000432Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763840445Host-AssociatedOpen in IMG/M
7000000436Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764487809Host-AssociatedOpen in IMG/M
7000000440Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763435843Host-AssociatedOpen in IMG/M
7000000457Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159571453Host-AssociatedOpen in IMG/M
7000000534Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763496533Host-AssociatedOpen in IMG/M
7000000563Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763820215Host-AssociatedOpen in IMG/M
7000000583Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160643649Host-AssociatedOpen in IMG/M
7000000599Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763961826 replicate 1Host-AssociatedOpen in IMG/M
7000000622Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 159753524Host-AssociatedOpen in IMG/M
7000000631Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 338793263Host-AssociatedOpen in IMG/M
7000000670Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160158126Host-AssociatedOpen in IMG/M
7000000676Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765013792Host-AssociatedOpen in IMG/M
7000000686Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765560005Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0102724_10363813300006996HumanLSPALHLAMKLFEAVVWATISYDSSDEVEGKGGMNAVPTAVDE*
Ga0103275_10261413300007204HumanMDRRASLRILSPALYLATKLFEAVVRTTISYDSSDEVEGKGGMNAIPTTVDE*
Ga0104339_10158223300007278HumanMDRRTSLRILSTALYLATKLFEAVVRATISYDPSDEVEGKGGMNAIPTAVDE*
Ga0104752_10488023300007284HumanMDRRASLRVLSTALHLATKLFEAVVWATIADDPSDEVEGKRGMNAIPTAVDE*
Ga0104843_10332833300007300HumanMDRRTSLRVLSPALYLATKLFEAVVRTTISYDPSDEVEGKGRMNTIPTAVDE*
Ga0104925_10145663300007318HumanMDRRTSLRVLSTALYLATKLFEAVVRTTISYDSSDEVEGKGGMNAIPTAVDE*
Ga0104940_100586933300007320HumanMDRRASLRILSPALHLAMKLFEAVVRTTISYDPSDEVEGKRGMNAIPTAVDE*
Ga0104969_105663323300007335HumanMDRRASLRILSPALYLATKLFEAVVRTTISYDSSDEVEGKRGMNAIPTAVDE*
Ga0104971_100354103300007339HumanMDRRTSLRVLSPALYLATKLFEAVVWTTISYDPSDEVEGKGGMNAIPTAVDE*
Ga0104762_100071073300007355HumanMDRRASLRILSPALYLATKLFEAVVRTTISYDPSDEVEGKGRMNAVPTAVDE*
Ga0104977_100063273300007368HumanMDRRASLRILSPALYLATKLFEAVVRTTISYDPSDEVEGKRGMNAIPTAVDE*
Ga0104979_10187123300007497HumanMDRRTSLRVLSTVLYFTTKLFKAVVRTTISYNPSDEVEGKGGMNAIPTAVDE*
Ga0105502_100499053300007531HumanMNGRTSLRILSTALYLATKLFEAVVRATISYDPSDEVEGKGGMNAIPTAVDE*
Ga0105502_105064323300007531HumanMDRRTSLRILSTVLYLATKLFEAVVWTTISYDPSDEVEGKGGMNAIPTAVDE*
Ga0105526_1000039403300007638HumanMDRRASLRILSPALHLAMKLFEAVVRTTISYDPSDEVEGKGGMNAIPTAVDE*
Ga0105537_100001793300007659HumanMDRRASLRVLSTALHLAPKLFEAVIWATIADDSSDEVEGKGRMNTIPTAVDEQTLGVL*
Ga0105539_10247943300007662HumanMDRRTSLRILSTVLYLATKLFKAVVRTTISYDPSDEVEGKGGMNAIPTAVDE*
Ga0105541_101566013300007663HumanILSTSLYLATKLFKAVVRTTISYDPSDEVEGKGGMNAIPTTVDE*
Ga0105754_100077283300007728HumanMDRRASLHILSPALYLATKLFEAVVWATISYDSSDEVEGKGGMNAVPTAVDE*
Ga0105776_100012883300007746HumanMDRRASLRILSPALHLATKLFEAVVRTTISYDPSDEVEGKRGMNAIPTAVDE*
Ga0105780_10841723300007803HumanMDGRTSLRVLSPALYLATKLFEAVVWTTIADDSRDEVEGKGGMNAVPTAVDE*
Ga0105958_10127143300007967HumanMDRRASLRILSPALHLATKLFEAAGRTTSSYDPSDEVEGKRGMNAIPTAVDE*
Ga0114094_100003773300007971HumanMDRRTSLRVLSTALYFATKLFKAVVRTTISYDSSDEVEGKGGMNAVPTTVDE*
Ga0113878_13319423300007994HumanMDRRTSLRVLSTALYLTTKLFKAVVRTTISYDSSDEVKGKGRMNAVPTAVDE*
Ga0111053_100024333300007997HumanMDRRTSLRILSTALYLATKLFKAVVRTTISYDPSDEVEGKRGMNAVPTAVDE*
Ga0111056_10450423300008061HumanMNGRASLRVLSTALHLATKLFEAVVRTTISYDPSDEVEGKGGMNAIPTAVDE*
Ga0114852_10678423300008074HumanMDRRASLRILSPALHLAMKLFEAVVRTTISYDSSDEVEGKGGMNAIPTAVDE*
Ga0105957_10073943300008080HumanMDRRTSLRVLSTALYLATKLFKAVVRTTISYDSSDEVEGKGGMNAIPTAVDE*
Ga0114856_100013663300008125HumanMDRGASLRILSTTLYLATKLFEAVVRTTISYDSSDEVKGKGGMNAIPTAVDE*
Ga0114846_10217643300008127HumanMDRRASLRVLSTALYLATKLFEAVVWTMISYDPSDEVEGKGGMNAIPTAVDE*
Ga0114847_10127423300008128HumanMDRRASLRVLSTALYLATKLFEAVIWATIADDSSDEVEGKGRMNTIPTAVDE*
Ga0114847_10193153300008128HumanMDRRTSLRVLSTALYLATKLFEAVVWATIADNPSDEVEGKGGMNAIPTAVDE*
Ga0111365_14651023300008133HumanMDRRTSLRILSTVLYLATKLFEAVVWTTISYDPSDEVEGKGGMNAIPTAGGGEALG
Ga0114165_1001195133300008140HumanMDRRASLRILSPALHLAMKLFEAVVRTTISYDSSDEVKGKGGMNAIPTAVDE*
Ga0114367_1000022333300008147HumanMDRRASLRILSPALYLATKFFKAVVRTTISYDPSDEVEGKGGMNAIPTAVDE*
Ga0114001_100835163300008155HumanMDRRTSLRILSTALYLATKLFKAVVRTTISYDPSDEVEGKGGMNAVPTAVDE*
Ga0114001_10496743300008155HumanMDRRTSLRILSPTLYLATKLFEAVVRTTISYDPSDEVEGKGGMNAIPTAVDE*
Ga0110913_100169723300008161HumanMDRRASLRILSPALYLATKLFKAVVRTMISYDPSDEVEGKGGMNAIPTAVDE*
Ga0114894_10315143300008331HumanMNGRTSLRILSTALYLATKLFEAVVRTTISYDPSDEVEGKGGMNAIPTAVDE*
Ga0115372_101524313300008334HumanMDRRASLRILSPALHLAMKLFEAVVRTTISYDPSDEVEGKRGMNAIPTAADE*
Ga0115411_103490913300008347HumanLATKLFEAVVRTTISYDSSDEVEGKGGMNAIPTTVDE*
Ga0115224_1000114413300008406HumanMDRRTSLRVLSTALYLATKLFEAVVWTTISYDPSDEVEGKGGMNAIPTAVDE*
Ga0115229_11665013300008413HumanMDRRTSLRILSPALHLAMKLFEAVVRTTISYDPSDEVEGKRGMNAIPTAVDE*
Ga0115225_10507733300008415HumanMDRRASLRILSPALHLTMKLFEAVVRTTISYDPSDEVESKRGMNAIPTAVDE*
Ga0115418_10383133300008436HumanMDRRTSLRVLSTALYLATKLFKAVVWTTISYDPSDEVEGKGGMNAVPTAVDE
Ga0115418_10694033300008436HumanMDRRASLRILSTALYLATKLFEAVVWATISYDSCDEVEGKGGMNAVPTAVDE*
Ga0115375_10056263300008474HumanMDRRTSLRILSTSLYLATKLFKAVVRTTISYDSSDEVEGKRGMNAIPTAVDE*
Ga0115196_1000793133300008486HumanMDRRASLRILSPALHLAMKLFEAVVRTTISYDPSDEVEGKGGMNAIPTTVDE*
Ga0114860_100007713300008504HumanMDRRTSLRVLSTALYLATKLFKAVVWTTISYDSSDEVEGKGGMNAIPTAVDE*
Ga0111023_100831103300008514HumanMDGRTSLRVLSPALYLATKLFEAVVWTTISYDPSDEVEGKGGMNAIPTAVDE*
Ga0115191_1000012213300008518HumanMDRRASLRVLSPALYLATKLFKAVVRTTISYDPSDEVEGKGGMNAIPTAVDE*
Ga0111054_100005403300008541HumanMDRRASLRILSPALYLATKLFEAVVRTTISYDPSDEVEGKGGMNAIPTTVDE*
Ga0111079_10378753300008575HumanMDRGASLRILSTALYLATKLFEAVVWTTISYDSSDEVEGKGGMNAIPTAVDE*
Ga0111079_12256933300008575HumanMDRRTSLRVLSTALYLATKLFKAVVRTTISYDPSDEVEGKGGMNAIPTAVDE*
Ga0111231_102134223300008615HumanMDRRASLRVLSPALYLATKLFKAVVRTTISYDPSDEVEGKGGMNAISTAVDE*
Ga0111423_11439013300008643HumanASGARARDRRASLRILSPALYLATKLFKAVVRTMISYDPSDEVEGKGGMNAIPTAVDE*
Ga0111492_10147863300008660HumanMDRRTSLRVLSPALYLATKLFEAVVWTTIADDSSDEVEGKGGMNAVPTAVDE*
Ga0113557_10754043300008695HumanMDRRASLRILSPALYLATKLFKAVVRTMISYDPSDEVEGKGGMNAIPTTVDE*
Ga0113557_10932953300008695HumanMDRRTSLRILSTALYLATKLFKAVVRTTISYDPSDEVEGKRGMNAVPTAGDGEAPGGL
Ga0114085_10075143300008748HumanMDRRTSLRILSTALYLATKLFEAVVRATISYDPSDEVEGKGRMNAIPTAVDE*
Ga0114085_11111413300008748HumanMDGRTSLRVLSTALYLATKLFEAVVWTTIADNSSDEVEGKGGMNAIPTAVDE*
Ga0115681_10652723300008749HumanMDRRTSLRVLSTALYLATKLFKAVVRTTISYDPSDEVEGKGRVNAIPTAVDE*
Ga0119795_1000072263300011986Human OralMDRRASLRILSPALHLTMKLFEAVVRTTISYDPSDEVEGKRGMNAIPTAVDE*
Ga0134350_100031343300014137Human OralMDRRASLRVLSTALYLATKLFEAVVRTTISYDSSDEVEGKGGMNAIPTTVDE*
Ga0134344_1000061203300014140Human OralMDRRASLRILSPALYLATKLFEAVVRTTISYDPSDEVEGKGGMNAISTAVDE*
Ga0134345_10355123300014554Human OralMNGRASLRVLSTALHLATKLFEAVVWATIADNSSNEVEGKGGMNAIPTAVDE*
Ga0119815_1000834123300014815Human OralMDRRASIRILSPALYLATKLFEAVVRTTISYDSSDEVEGKGGMNAIPTTVDE*
SRS022536_LANL_scaffold_124411__gene_2724887000000005HumanMDRRTSLRILSTSLYLATKLFKAVVRTTISYDSSDEVEGKRGMNAVPTAVDE
SRS042131_WUGC_scaffold_1367__gene_14327000000029HumanMDRRTSLRVLSTALYLATKLFEAVVRTTISYDSSDEVEGKGGMNAIPTAVDE
SRS042131_WUGC_scaffold_46931__gene_773057000000029HumanMDRRASLRVLSTALHLATKLFEAVVWATIADDPSDEVEGKRGMNAIPTAVDE
SRS023835_Baylor_scaffold_30478__gene_315227000000042HumanMDRRTSLRILSTVLYLATKLFEAVVWTTISYDPSDEVEGKGGMNAIPTAVDE
C2837855__gene_1596037000000058HumanQCTRSMDRRTSLRVLSTALYLATKLFKAVVRTTISYDSSDEVEGKGGMNAIPTAVDE
SRS014888_WUGC_scaffold_6531__gene_62327000000061HumanMDRRASLRILSTVLYLATKLFKAVVRTTISYDPSDEVEGKGGMNAIPTAVDE
SRS021496_Baylor_scaffold_36952__gene_475597000000073HumanMDRRTSLRILSTALYLATKLFEAVVRATISYDPSDEVEGKGGMNAIPTAVDE
SRS055426_LANL_scaffold_48409__gene_533857000000099HumanMDRRTSLRVLSPALYLATKLFEAVVWTTIADDSSDEVEGKGGMNAVPTAVDE
SRS011306_Baylor_scaffold_57155__gene_690547000000109HumanMDRRASLRVLSPALYLATKLFKAVVRTTISYDPSDEVEGKGGMNAIPTAVDE
SRS015941_WUGC_scaffold_12936__gene_145217000000125HumanMDRRASLRILSPALYLATKLFKAVVRTTISYDPSDEVEGKGRMNTIPTAVDE
C1787042__gene_1004977000000126HumanMDRRASLRILSPALYLATKLFEAVVRTTISYDSSDEVEGKGGMNAIPTTVDE
SRS013881_WUGC_scaffold_6283__gene_56927000000149HumanMDRRTSLRVLSTVLYFTTKLFKAVVRTTISYNPSDEVEGKGGMNAIPTAVDE
C2094736__gene_921147000000182HumanMDRRASLRILSPALYLATKLFEAVVRTTISYDPSDEVEGKGRMNAVPTAVDE
SRS022602_Baylor_scaffold_121503__gene_1644467000000228HumanMDRRTSLRILSTALYLATKLFKAVVRTTISYDPSDEVEGKRGMNAVPTAVDE
SRS015762_WUGC_scaffold_25647__gene_291527000000240HumanMNGRTSLRILSTALYLATKLFEAVVRATISYDPSDEVEGKGGMNAIPTAVDE
SRS016575_Baylor_scaffold_224__gene_2837000000244HumanMDRRASLRILSPALHLAMKLFEAVVRTTISYDPSDEVEGKGGMNAIPTAVDE
SRS054569_LANL_scaffold_25570__gene_298557000000253HumanMDRRASLRVLSTALHLAPKLFEAVIWATIADDSSDEVEGKGRMNTIPTAVDEQTLGVL
SRS065335_LANL_scaffold_5343__gene_65827000000255HumanMDRRTSLRILSTVLYLATKLFKAVVRTTISYDSSDEVEGKGGMNAIPTAVDE
SRS024087_LANL_scaffold_72976__gene_1069277000000288HumanMDRRASLRVLSTALYLATKLFEAVVWTMISYDPSDEVEGKGGMNAIPTAVDE
SRS017511_Baylor_scaffold_95824__gene_1261107000000316HumanMDRRASLRILSPALHLATKLFEAVVRTTISYDPSDEVEGKRGMNAIPTAVDE
C5265137__gene_2047027000000371HumanMDRRASLHILSPALYLATKLFEAVVWATISYDSSDEVEGKGGMNAVPTAVDE
SRS049268_LANL_scaffold_31090__gene_353257000000396HumanMDRRASLRILSPALYLATKLFEAVVRTTISYDPSDEVEGKGGMNAIPTTVDE
SRS063193_LANL_scaffold_7826__gene_76827000000432HumanMDRRASLRILSPALYLATKLFEAVVRTTISYDPSDEVEGKGRMNTIPTAVDE
SRS015644_WUGC_scaffold_47957__gene_785407000000436HumanLQLVSRTEEELKCTRSMDRRASLRVLSTALHLATKLFEAVVWATIADDPSDEVEGKRGMNAIPTAVDE
SRS015797_WUGC_scaffold_23927__gene_291897000000440HumanMDRRTSLRILSTVLYLATKLFEAVVWATIADNSSNEVEGKGRMNTIPTAVDE
SRS024447_LANL_scaffold_6225__gene_59767000000457HumanMDRRTSLRILSPTLYLATKLFEAVVRTTISYDPSDEVEGKGGMNAIPTAVDE
C4342009__gene_1650537000000534HumanMDRGASLRILSTTLYLATKLFEAVVRTTISYDSSDEVKGKGGMNAIPTAVDE
C2593508__gene_951947000000563HumanMDRRTSLRVLSPALYLATKLFKAVVRTTISYDSSDEVEGKGGMNAIPTAVDE
SRS019974_Baylor_scaffold_156__gene_1917000000583HumanMDRRTSLRVLSTALYFATKLFKAVVRTTISYDSSDEVEGKGGMNAVPTTVDE
SRS019022_WUGC_scaffold_29076__gene_283247000000599HumanMDRRASLRILSPALYLATKFFKAVVRTTISYDPSDEVEGKGGMNAIPTAVDE
SRS077736_LANL_scaffold_37853__gene_555137000000622HumanMDRRTSLRVLSTALYLATKLFKAVVWTTISYDSSDEVEGKGGMNAIPTAVDE
SRS050029_WUGC_scaffold_6986__gene_85677000000631HumanMDGRTSLRVLSPALYLATKLFEAVVWTTIADDSRDEVEGKGGMNAVPTAVDE
C4880171__gene_2614327000000670HumanMDRRASLRILSPALHLAMKLFEAVVRTTISYDPSDEVEGKGGMNAIPTTVDE
C3680823__gene_1795297000000676HumanMDRRASLRILSPALHLTMKLFEAVVRTTISYDPSDEVESKRGMNAIPT
SRS018665_WUGC_scaffold_59418__gene_768427000000676HumanMDRRASLRILSPALYLATKLFKAVVRTMISYDPSDEVEGKGGMNAIPTAVDE
C1769828__gene_1012077000000686HumanMDRRASLRILSPALHLAMKLFEAVVRTTISYDPSDEVEGKRGMNAIPTA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.