| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006996 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052630 | Ga0102724 |
| Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 370425937 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 22910927 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria mucosa | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067846 | Metagenome | 125 | Y |
| F098763 | Metagenome | 103 | N |
| F103431 | Metagenome | 101 | N |
| F103436 | Metagenome | 101 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0102724_100522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria mucosa | 4247 | Open in IMG/M |
| Ga0102724_103638 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae | 1134 | Open in IMG/M |
| Ga0102724_108341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 606 | Open in IMG/M |
| Ga0102724_109878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus | 532 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0102724_100522 | Ga0102724_1005222 | F103431 | MIDLDALIVGMLFFIQLFLQGIAWRVAIAHFLHAERGNAAAAAFDGAFGENIANCHAEDDNDKDAESQKEGFHVCIPEG* |
| Ga0102724_103638 | Ga0102724_1036381 | F098763 | LSPALHLAMKLFEAVVWATISYDSSDEVEGKGGMNAVPTAVDE* |
| Ga0102724_108341 | Ga0102724_1083412 | F067846 | TAYDKAQEQYDAYGRAIEMEIESIKEDIANCDDDVICVFREKMLDYDEVINAFDDDTFNDDEFIKAVALGTDYEEIRIKILVAMAEDRLEQLEEDYRKGYILND* |
| Ga0102724_109878 | Ga0102724_1098781 | F103436 | MKTTSKDGWCDKSDAEILNSLRDWVLKCDLKYSKREALKKIDSAFALWGGRQYVAAVDLLDENEVYFSKEDWPYYALGIEILKARKYT |
| ⦗Top⦘ |