NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006996

3300006996: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 370425937



Overview

Basic Information
IMG/M Taxon OID3300006996 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052630 | Ga0102724
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 370425937
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size22910927
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria mucosa1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067846Metagenome125Y
F098763Metagenome103N
F103431Metagenome101N
F103436Metagenome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0102724_100522All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria mucosa4247Open in IMG/M
Ga0102724_103638All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae1134Open in IMG/M
Ga0102724_108341All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae606Open in IMG/M
Ga0102724_109878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus532Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0102724_100522Ga0102724_1005222F103431MIDLDALIVGMLFFIQLFLQGIAWRVAIAHFLHAERGNAAAAAFDGAFGENIANCHAEDDNDKDAESQKEGFHVCIPEG*
Ga0102724_103638Ga0102724_1036381F098763LSPALHLAMKLFEAVVWATISYDSSDEVEGKGGMNAVPTAVDE*
Ga0102724_108341Ga0102724_1083412F067846TAYDKAQEQYDAYGRAIEMEIESIKEDIANCDDDVICVFREKMLDYDEVINAFDDDTFNDDEFIKAVALGTDYEEIRIKILVAMAEDRLEQLEEDYRKGYILND*
Ga0102724_109878Ga0102724_1098781F103436MKTTSKDGWCDKSDAEILNSLRDWVLKCDLKYSKREALKKIDSAFALWGGRQYVAAVDLLDENEVYFSKEDWPYYALGIEILKARKYT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.