| Basic Information | |
|---|---|
| Family ID | F070093 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 25.20 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.496 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces (46.342 % of family members) |
| Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut (82.927 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.81% β-sheet: 0.00% Coil/Unstructured: 76.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF08241 | Methyltransf_11 | 4.07 |
| PF00005 | ABC_tran | 3.25 |
| PF08340 | DUF1732 | 3.25 |
| PF06968 | BATS | 3.25 |
| PF02934 | GatB_N | 3.25 |
| PF12710 | HAD | 2.44 |
| PF00710 | Asparaginase | 2.44 |
| PF10825 | DUF2752 | 1.63 |
| PF02637 | GatB_Yqey | 1.63 |
| PF03952 | Enolase_N | 1.63 |
| PF06969 | HemN_C | 1.63 |
| PF00664 | ABC_membrane | 1.63 |
| PF14286 | DHHW | 1.63 |
| PF03061 | 4HBT | 1.63 |
| PF01208 | URO-D | 1.63 |
| PF12146 | Hydrolase_4 | 1.63 |
| PF00486 | Trans_reg_C | 1.63 |
| PF13186 | SPASM | 1.63 |
| PF02774 | Semialdhyde_dhC | 1.63 |
| PF00814 | TsaD | 1.63 |
| PF00588 | SpoU_methylase | 1.63 |
| PF12848 | ABC_tran_Xtn | 1.63 |
| PF00929 | RNase_T | 1.63 |
| PF01797 | Y1_Tnp | 1.63 |
| PF02518 | HATPase_c | 1.63 |
| PF02607 | B12-binding_2 | 1.63 |
| PF13407 | Peripla_BP_4 | 0.81 |
| PF10431 | ClpB_D2-small | 0.81 |
| PF00768 | Peptidase_S11 | 0.81 |
| PF14574 | RACo_C_ter | 0.81 |
| PF11167 | DUF2953 | 0.81 |
| PF13333 | rve_2 | 0.81 |
| PF05698 | Trigger_C | 0.81 |
| PF02880 | PGM_PMM_III | 0.81 |
| PF04883 | HK97-gp10_like | 0.81 |
| PF13375 | RnfC_N | 0.81 |
| PF00903 | Glyoxalase | 0.81 |
| PF13556 | HTH_30 | 0.81 |
| PF00275 | EPSP_synthase | 0.81 |
| PF09826 | Beta_propel | 0.81 |
| PF12802 | MarR_2 | 0.81 |
| PF01734 | Patatin | 0.81 |
| PF09084 | NMT1 | 0.81 |
| PF02826 | 2-Hacid_dh_C | 0.81 |
| PF13189 | Cytidylate_kin2 | 0.81 |
| PF03692 | CxxCxxCC | 0.81 |
| PF06050 | HGD-D | 0.81 |
| PF05175 | MTS | 0.81 |
| PF00248 | Aldo_ket_red | 0.81 |
| PF01025 | GrpE | 0.81 |
| PF09587 | PGA_cap | 0.81 |
| PF03466 | LysR_substrate | 0.81 |
| PF03462 | PCRF | 0.81 |
| PF08220 | HTH_DeoR | 0.81 |
| PF12390 | Se-cys_synth_N | 0.81 |
| PF01522 | Polysacc_deac_1 | 0.81 |
| PF01717 | Meth_synt_2 | 0.81 |
| PF01336 | tRNA_anti-codon | 0.81 |
| PF02645 | DegV | 0.81 |
| PF12681 | Glyoxalase_2 | 0.81 |
| PF00171 | Aldedh | 0.81 |
| PF14667 | Polysacc_synt_C | 0.81 |
| PF08876 | DUF1836 | 0.81 |
| PF00302 | CAT | 0.81 |
| PF01425 | Amidase | 0.81 |
| PF13303 | PTS_EIIC_2 | 0.81 |
| PF02386 | TrkH | 0.81 |
| PF13474 | SnoaL_3 | 0.81 |
| PF08281 | Sigma70_r4_2 | 0.81 |
| PF01817 | CM_2 | 0.81 |
| PF16916 | ZT_dimer | 0.81 |
| PF01758 | SBF | 0.81 |
| PF01497 | Peripla_BP_2 | 0.81 |
| PF02686 | Glu-tRNAGln | 0.81 |
| PF02508 | Rnf-Nqr | 0.81 |
| PF16189 | Creatinase_N_2 | 0.81 |
| PF02254 | TrkA_N | 0.81 |
| PF00226 | DnaJ | 0.81 |
| PF00072 | Response_reg | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 4.88 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 4.88 |
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 4.88 |
| COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 3.25 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 1.63 |
| COG1610 | Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activity | General function prediction only [R] | 1.63 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 1.63 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.63 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 1.63 |
| COG0635 | Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductase | Coenzyme transport and metabolism [H] | 1.63 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 1.63 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 1.63 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 1.63 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 1.63 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 1.63 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 1.63 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.81 |
| COG4845 | Chloramphenicol O-acetyltransferase | Defense mechanisms [V] | 0.81 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.81 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.81 |
| COG1775 | Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB | Amino acid transport and metabolism [E] | 0.81 |
| COG4660 | Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfE subunit | Energy production and conversion [C] | 0.81 |
| COG2209 | Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrE | Energy production and conversion [C] | 0.81 |
| COG4657 | Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfA subunit | Energy production and conversion [C] | 0.81 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.81 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.81 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.81 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.81 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.81 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0168 | Trk-type K+ transport system, membrane component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0576 | Molecular chaperone GrpE (heat shock protein HSP-70) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0721 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.81 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1347 | Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrD | Energy production and conversion [C] | 0.81 |
| COG1605 | Chorismate mutase | Amino acid transport and metabolism [E] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.50 % |
| Unclassified | root | N/A | 6.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300006502|Ga0100528_102759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 8076 | Open in IMG/M |
| 3300010275|Ga0129310_1086905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 561 | Open in IMG/M |
| 3300014935|Ga0169825_113651 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300014963|Ga0134523_1033761 | Not Available | 1857 | Open in IMG/M |
| 3300014963|Ga0134523_1057815 | Not Available | 1136 | Open in IMG/M |
| 3300023290|Ga0256628_107627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3456 | Open in IMG/M |
| 3300023543|Ga0257048_101825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 12898 | Open in IMG/M |
| 3300028968|Ga0169714_101123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 15210 | Open in IMG/M |
| 3300029021|Ga0169710_107638 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
| 3300029044|Ga0169677_1016136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2024 | Open in IMG/M |
| 3300029099|Ga0169186_100474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 48088 | Open in IMG/M |
| 3300029099|Ga0169186_100763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 30982 | Open in IMG/M |
| 3300029099|Ga0169186_101568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 13843 | Open in IMG/M |
| 3300029099|Ga0169186_106473 | All Organisms → cellular organisms → Bacteria | 3148 | Open in IMG/M |
| 3300029099|Ga0169186_107756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2685 | Open in IMG/M |
| 3300029120|Ga0168814_147028 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300029122|Ga0168799_1013181 | Not Available | 1927 | Open in IMG/M |
| 3300029126|Ga0168786_102511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 6816 | Open in IMG/M |
| 3300029134|Ga0168775_100335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 66641 | Open in IMG/M |
| 3300029134|Ga0168775_115018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2123 | Open in IMG/M |
| 3300029185|Ga0168712_108495 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300029194|Ga0168692_100999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 13051 | Open in IMG/M |
| 3300029203|Ga0168704_100765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 17342 | Open in IMG/M |
| 3300029203|Ga0168704_107580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2685 | Open in IMG/M |
| 3300029209|Ga0168673_101192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 18013 | Open in IMG/M |
| 3300029209|Ga0168673_106140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3384 | Open in IMG/M |
| 3300029234|Ga0168698_104910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 5926 | Open in IMG/M |
| 3300029234|Ga0168698_108995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2871 | Open in IMG/M |
| 3300029236|Ga0169721_106850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 4515 | Open in IMG/M |
| 3300029249|Ga0168690_1007842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3371 | Open in IMG/M |
| 3300029253|Ga0168699_1004172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 6552 | Open in IMG/M |
| 3300029256|Ga0168827_101153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 27028 | Open in IMG/M |
| 3300029315|Ga0242753_101784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 18210 | Open in IMG/M |
| 3300029325|Ga0242844_107083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1988 | Open in IMG/M |
| 3300029332|Ga0243782_110745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2692 | Open in IMG/M |
| 3300029333|Ga0243760_111511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2717 | Open in IMG/M |
| 3300029335|Ga0243762_110130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3755 | Open in IMG/M |
| 3300029335|Ga0243762_115822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 2148 | Open in IMG/M |
| 3300029336|Ga0243752_102222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 15942 | Open in IMG/M |
| 3300029339|Ga0242823_1004375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 7289 | Open in IMG/M |
| 3300029339|Ga0242823_1015137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1982 | Open in IMG/M |
| 3300029343|Ga0243725_1028378 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300029348|Ga0243800_100055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 199931 | Open in IMG/M |
| 3300029350|Ga0243859_100980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 26823 | Open in IMG/M |
| 3300029356|Ga0243797_100129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 156275 | Open in IMG/M |
| 3300029358|Ga0243818_1000349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 71705 | Open in IMG/M |
| 3300029361|Ga0243815_1028623 | Not Available | 1289 | Open in IMG/M |
| 3300029369|Ga0243960_130032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 637 | Open in IMG/M |
| 3300029370|Ga0243957_127194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 559 | Open in IMG/M |
| 3300029372|Ga0243963_103016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 8469 | Open in IMG/M |
| 3300029373|Ga0243914_101369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 25192 | Open in IMG/M |
| 3300029373|Ga0243914_114159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1623 | Open in IMG/M |
| 3300029375|Ga0243934_1000896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 45027 | Open in IMG/M |
| 3300029384|Ga0243983_1002768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 10210 | Open in IMG/M |
| 3300029385|Ga0243985_1024767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1376 | Open in IMG/M |
| 3300029399|Ga0242750_105132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3449 | Open in IMG/M |
| 3300029402|Ga0243962_100678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Mediterraneibacter → [Ruminococcus] torques | 31691 | Open in IMG/M |
| 3300029402|Ga0243962_102114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 10251 | Open in IMG/M |
| 3300029402|Ga0243962_109132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2153 | Open in IMG/M |
| 3300029405|Ga0243959_128252 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300029407|Ga0243764_100999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 21993 | Open in IMG/M |
| 3300029411|Ga0243861_100116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 126144 | Open in IMG/M |
| 3300029411|Ga0243861_104383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 4823 | Open in IMG/M |
| 3300029411|Ga0243861_110531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2078 | Open in IMG/M |
| 3300029411|Ga0243861_111890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1855 | Open in IMG/M |
| 3300029412|Ga0243915_101729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 19500 | Open in IMG/M |
| 3300029414|Ga0243798_101558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 19976 | Open in IMG/M |
| 3300029419|Ga0243913_100373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 79371 | Open in IMG/M |
| 3300029423|Ga0243802_101512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 22760 | Open in IMG/M |
| 3300029426|Ga0242789_100712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 44830 | Open in IMG/M |
| 3300029426|Ga0242789_101214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 24191 | Open in IMG/M |
| 3300029428|Ga0242788_101337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 24209 | Open in IMG/M |
| 3300029428|Ga0242788_102722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 9956 | Open in IMG/M |
| 3300029430|Ga0243922_101744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 22718 | Open in IMG/M |
| 3300029431|Ga0243758_1028962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 928 | Open in IMG/M |
| 3300029433|Ga0243761_1011871 | All Organisms → cellular organisms → Bacteria | 3002 | Open in IMG/M |
| 3300029433|Ga0243761_1027412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1077 | Open in IMG/M |
| 3300029434|Ga0243855_1003533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 10247 | Open in IMG/M |
| 3300029437|Ga0242826_1012376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2741 | Open in IMG/M |
| 3300029476|Ga0244146_101253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 20043 | Open in IMG/M |
| 3300029476|Ga0244146_113252 | Not Available | 1433 | Open in IMG/M |
| 3300029480|Ga0244079_105285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 4073 | Open in IMG/M |
| 3300029487|Ga0244179_103540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 8652 | Open in IMG/M |
| 3300029488|Ga0244072_118432 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300029508|Ga0244830_108626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1793 | Open in IMG/M |
| 3300029511|Ga0244809_100987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 21798 | Open in IMG/M |
| 3300029511|Ga0244809_102631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 6931 | Open in IMG/M |
| 3300029516|Ga0244799_128671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 681 | Open in IMG/M |
| 3300029519|Ga0244840_100346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 63225 | Open in IMG/M |
| 3300029519|Ga0244840_100506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 48153 | Open in IMG/M |
| 3300029520|Ga0244801_108367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3273 | Open in IMG/M |
| 3300029521|Ga0244833_102948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 9783 | Open in IMG/M |
| 3300029521|Ga0244833_108588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2800 | Open in IMG/M |
| 3300029530|Ga0244962_100313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 74939 | Open in IMG/M |
| 3300029530|Ga0244962_100321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 73855 | Open in IMG/M |
| 3300029530|Ga0244962_100970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 26641 | Open in IMG/M |
| 3300029530|Ga0244962_103548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 4939 | Open in IMG/M |
| 3300029531|Ga0244920_104195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 4635 | Open in IMG/M |
| 3300029543|Ga0244989_107783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2639 | Open in IMG/M |
| 3300029556|Ga0244975_105211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3932 | Open in IMG/M |
| 3300029571|Ga0244922_110775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2808 | Open in IMG/M |
| 3300029571|Ga0244922_124289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1146 | Open in IMG/M |
| 3300029590|Ga0245099_1006360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 6511 | Open in IMG/M |
| 3300029593|Ga0245135_102033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 10133 | Open in IMG/M |
| 3300029633|Ga0242758_101011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 15898 | Open in IMG/M |
| 3300029713|Ga0245252_103599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 9716 | Open in IMG/M |
| 3300029735|Ga0245259_123975 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300029735|Ga0245259_134046 | Not Available | 670 | Open in IMG/M |
| 3300029751|Ga0168701_100678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 22058 | Open in IMG/M |
| 3300029751|Ga0168701_103740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 5118 | Open in IMG/M |
| 3300029756|Ga0242840_100797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 31622 | Open in IMG/M |
| 3300029758|Ga0242784_102777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 7499 | Open in IMG/M |
| 3300029761|Ga0243857_100357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 66537 | Open in IMG/M |
| 3300029769|Ga0243863_102924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 9058 | Open in IMG/M |
| 3300029776|Ga0243759_124959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1218 | Open in IMG/M |
| 3300029777|Ga0243715_1063924 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300029785|Ga0243763_1015799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 2409 | Open in IMG/M |
| 3300029786|Ga0243817_1011737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2742 | Open in IMG/M |
| 3300029786|Ga0243817_1018693 | Not Available | 1794 | Open in IMG/M |
| 3300029815|Ga0244882_1021567 | Not Available | 2015 | Open in IMG/M |
| 3300029819|Ga0245024_100355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 75164 | Open in IMG/M |
| 3300029861|Ga0245310_111128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2484 | Open in IMG/M |
| 3300029861|Ga0245310_118979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Acetivibrio → Acetivibrio ethanolgignens | 1372 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Human Feces | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces | 46.34% |
| Human Fecal | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal | 27.64% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 14.63% |
| Human Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated | 8.13% |
| Human Gut | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut | 1.63% |
| Human | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human | 0.81% |
| Western Lowland Gorilla Individual Fecal | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Western Lowland Gorilla Individual Fecal | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300006502 | Human stool microbial communities from NIH, USA - visit 1, subject 764588959 | Host-Associated | Open in IMG/M |
| 3300010275 | Western lowland gorrila individual fecal microbial communities from Wisconsin, USA - Go1022A metagenome | Host-Associated | Open in IMG/M |
| 3300014935 | Human fecal microbial communities from infant at 12 months in Denmark - 598_12M | Host-Associated | Open in IMG/M |
| 3300014963 | Human fecal microbial communities from elderly subjects during probiotic consumption in Boston, USA - meta_42827d56 | Host-Associated | Open in IMG/M |
| 3300023290 | Human gut microbial communities from healthy child feces in Northridge, California, USA -- CDI_10B | Host-Associated | Open in IMG/M |
| 3300023543 | Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_42C | Host-Associated | Open in IMG/M |
| 3300028968 | Human fecal microbial communities from infant at 12 months in Denmark - 504_12M | Host-Associated | Open in IMG/M |
| 3300029021 | Human fecal microbial communities from infant at 12 months in Denmark - 503_12M | Host-Associated | Open in IMG/M |
| 3300029044 | Human fecal microbial communities from mother in Denmark - 377_M | Host-Associated | Open in IMG/M |
| 3300029099 | Human fecal microbial communities from infant at 12 months in Denmark - 128_12M | Host-Associated | Open in IMG/M |
| 3300029120 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021209-24 | Host-Associated | Open in IMG/M |
| 3300029122 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI019857-129 | Host-Associated | Open in IMG/M |
| 3300029126 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI019844-87 | Host-Associated | Open in IMG/M |
| 3300029134 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI019832-40 | Host-Associated | Open in IMG/M |
| 3300029185 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI012056-15 | Host-Associated | Open in IMG/M |
| 3300029194 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011681-56 | Host-Associated | Open in IMG/M |
| 3300029203 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011703-95 | Host-Associated | Open in IMG/M |
| 3300029209 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002611-17 | Host-Associated | Open in IMG/M |
| 3300029234 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011691-140 | Host-Associated | Open in IMG/M |
| 3300029236 | Human fecal microbial communities from mother in Denmark - 507_M | Host-Associated | Open in IMG/M |
| 3300029249 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011676-93 | Host-Associated | Open in IMG/M |
| 3300029253 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011692-133 | Host-Associated | Open in IMG/M |
| 3300029256 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021226-74 | Host-Associated | Open in IMG/M |
| 3300029315 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 001_6_5_stool_1 | Host-Associated | Open in IMG/M |
| 3300029325 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 016_6_7_stool_1 | Host-Associated | Open in IMG/M |
| 3300029332 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 042_10_27_stool_1 | Host-Associated | Open in IMG/M |
| 3300029333 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_29_stool_2 | Host-Associated | Open in IMG/M |
| 3300029335 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_31_stool_1 | Host-Associated | Open in IMG/M |
| 3300029336 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 029_10_29_stool_1 | Host-Associated | Open in IMG/M |
| 3300029339 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 015_6_2_stool_1 | Host-Associated | Open in IMG/M |
| 3300029343 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 025_10_26_stool_1 | Host-Associated | Open in IMG/M |
| 3300029348 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_29_stool_2 | Host-Associated | Open in IMG/M |
| 3300029350 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_11_stool_2 | Host-Associated | Open in IMG/M |
| 3300029356 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_28_stool_1 | Host-Associated | Open in IMG/M |
| 3300029358 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 046_3_12_stool_2 | Host-Associated | Open in IMG/M |
| 3300029361 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 046_3_10_stool_1 | Host-Associated | Open in IMG/M |
| 3300029369 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_4_30_stool_1 | Host-Associated | Open in IMG/M |
| 3300029370 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_4_27_stool_1 | Host-Associated | Open in IMG/M |
| 3300029372 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_5_2_stool_2 | Host-Associated | Open in IMG/M |
| 3300029373 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 076_4_28_stool_1 | Host-Associated | Open in IMG/M |
| 3300029375 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 079_4_28_stool_1 | Host-Associated | Open in IMG/M |
| 3300029384 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 091_5_1_stool_1 | Host-Associated | Open in IMG/M |
| 3300029385 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 091_5_3_stool_1 | Host-Associated | Open in IMG/M |
| 3300029399 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 001_6_3_stool_2 | Host-Associated | Open in IMG/M |
| 3300029402 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_5_2_stool_1 | Host-Associated | Open in IMG/M |
| 3300029405 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_4_29_stool_1 | Host-Associated | Open in IMG/M |
| 3300029407 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 038_10_27_stool_1 | Host-Associated | Open in IMG/M |
| 3300029411 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_13_stool_2 | Host-Associated | Open in IMG/M |
| 3300029412 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 076_4_29_stool_1 | Host-Associated | Open in IMG/M |
| 3300029414 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_28_stool_2 | Host-Associated | Open in IMG/M |
| 3300029419 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 076_4_27_stool_2 | Host-Associated | Open in IMG/M |
| 3300029423 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_30_stool_2 | Host-Associated | Open in IMG/M |
| 3300029426 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_3_stool_2 | Host-Associated | Open in IMG/M |
| 3300029428 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_3_stool_1 | Host-Associated | Open in IMG/M |
| 3300029430 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 077_4_27_stool_1 | Host-Associated | Open in IMG/M |
| 3300029431 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_28_stool_1 | Host-Associated | Open in IMG/M |
| 3300029433 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_30_stool_1 | Host-Associated | Open in IMG/M |
| 3300029434 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 053_3_8_stool_1 | Host-Associated | Open in IMG/M |
| 3300029437 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 015_6_4_stool_2 | Host-Associated | Open in IMG/M |
| 3300029476 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001904-94 | Host-Associated | Open in IMG/M |
| 3300029480 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001834-56 | Host-Associated | Open in IMG/M |
| 3300029487 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001937-24 | Host-Associated | Open in IMG/M |
| 3300029488 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001827-39 | Host-Associated | Open in IMG/M |
| 3300029508 | Human fecal microbial communities from Shanghai Jiao Tong University, China - SZAXPI012158-36 | Host-Associated | Open in IMG/M |
| 3300029511 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005376-42 | Host-Associated | Open in IMG/M |
| 3300029516 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005366-25 | Host-Associated | Open in IMG/M |
| 3300029519 | Human fecal microbial communities from Shanghai Jiao Tong University, China - SZAXPI012175-89 | Host-Associated | Open in IMG/M |
| 3300029520 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005368-32 | Host-Associated | Open in IMG/M |
| 3300029521 | Human fecal microbial communities from Shanghai Jiao Tong University, China - SZAXPI012168-57 | Host-Associated | Open in IMG/M |
| 3300029530 | Human fecal microbial communities from Shanghai, China - P057V6 | Host-Associated | Open in IMG/M |
| 3300029531 | Human fecal microbial communities from Shanghai, China - P033V6 | Host-Associated | Open in IMG/M |
| 3300029543 | Human fecal microbial communities from Shanghai, China - P083V1 | Host-Associated | Open in IMG/M |
| 3300029556 | Human fecal microbial communities from Shanghai, China - P073V1 | Host-Associated | Open in IMG/M |
| 3300029571 | Human fecal microbial communities from Shanghai, China - P034V6 | Host-Associated | Open in IMG/M |
| 3300029590 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35392 | Host-Associated | Open in IMG/M |
| 3300029593 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36011 | Host-Associated | Open in IMG/M |
| 3300029633 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 001_6_7_stool_2 | Host-Associated | Open in IMG/M |
| 3300029713 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37182R1 | Host-Associated | Open in IMG/M |
| 3300029735 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37222 | Host-Associated | Open in IMG/M |
| 3300029751 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011698-46 | Host-Associated | Open in IMG/M |
| 3300029756 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 016_6_5_stool_1 | Host-Associated | Open in IMG/M |
| 3300029758 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_1_stool_1 | Host-Associated | Open in IMG/M |
| 3300029761 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_10_stool_1 | Host-Associated | Open in IMG/M |
| 3300029769 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_14_stool_2 | Host-Associated | Open in IMG/M |
| 3300029776 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_29_stool_1 | Host-Associated | Open in IMG/M |
| 3300029777 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 023_10_29_stool_2 | Host-Associated | Open in IMG/M |
| 3300029785 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_31_stool_2 | Host-Associated | Open in IMG/M |
| 3300029786 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 046_3_12_stool_1 | Host-Associated | Open in IMG/M |
| 3300029815 | Human fecal microbial communities from Shanghai, China - P010V6 | Host-Associated | Open in IMG/M |
| 3300029819 | Human fecal microbial communities from Shanghai, China - P103V6 | Host-Associated | Open in IMG/M |
| 3300029861 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37399 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0100528_1027591 | 3300006502 | Human | NFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPKLNPN* |
| Ga0129310_10869051 | 3300010275 | Western Lowland Gorilla Individual Fecal | LLLAEFCPFRIDPPMEPEQERLSKLYSGPGIQRLLN* |
| Ga0169825_1136512 | 3300014935 | Human Host-Associated | PFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPKSI* |
| Ga0134523_10337612 | 3300014963 | Human Fecal | SNFESLLLAEFCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPN* |
| Ga0134523_10578152 | 3300014963 | Human Fecal | EFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN* |
| Ga0256628_1076271 | 3300023290 | Human Gut | LLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNYADSIS |
| Ga0257048_1018251 | 3300023543 | Human Gut | LAEFCPFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPN |
| Ga0169714_1011231 | 3300028968 | Human Host-Associated | FESLLLAEFCPFRIDPPMEPEQERLFKLYSGSGIQSLPELNPNLI |
| Ga0169710_1076384 | 3300029021 | Human Host-Associated | CSFRIDPPMEPEQERFSKLYSGSGIHSLPELNPKSI |
| Ga0169677_10161364 | 3300029044 | Human Host-Associated | SLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPKQI |
| Ga0169186_1004741 | 3300029099 | Human Host-Associated | SNFESLLLAEFCPFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPN |
| Ga0169186_10076326 | 3300029099 | Human Host-Associated | ESLLLAEFCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPKNVLTLCNAVL |
| Ga0169186_10156816 | 3300029099 | Human Host-Associated | VSNFESLLLAEFCPFRIDPPIEPEQEHLSKLYSGSGIHSLSELNPKSTQTLS |
| Ga0169186_1064735 | 3300029099 | Human Host-Associated | SNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNYADSIS |
| Ga0169186_1077561 | 3300029099 | Human Host-Associated | RIDPPMEPEQERLFKLYSGSGIHSLPELNPNLLQNIYRM |
| Ga0168814_1470281 | 3300029120 | Host-Associated | FESLLLAEFCPFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPNPL |
| Ga0168799_10131812 | 3300029122 | Host-Associated | FYPFRIDLPMEPEQERLFKLYSGSGIHSLPELNPN |
| Ga0168786_1025117 | 3300029126 | Host-Associated | CPFRIDPPMEPEQERLFKLYSGSGIQSLPELNPNLI |
| Ga0168775_10033555 | 3300029134 | Host-Associated | EFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0168775_1150184 | 3300029134 | Host-Associated | VSNFESLLLAEFYPFRIDPPMKPEQERLFKLYSGSGIHSLPELNPNLLQNIHRM |
| Ga0168712_1084952 | 3300029185 | Host-Associated | EFYPFRIDPPMEPEQERLFKLYSGSGIQSLPELNPNLI |
| Ga0168692_10099912 | 3300029194 | Host-Associated | CRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNFMEANQ |
| Ga0168704_1007651 | 3300029203 | Host-Associated | CRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPYPL |
| Ga0168704_1075801 | 3300029203 | Host-Associated | LAEFCPFRIDPPMEPEQERLFKLYSGSGIHSLPELNPN |
| Ga0168673_1011921 | 3300029209 | Host-Associated | CRVSNFESLLLAEFCPFRIDPPMEPEQERLFKLYSGSGIQSLPELNSKLNPNLFQRI |
| Ga0168673_1061401 | 3300029209 | Host-Associated | FRIDPPMEPEQERLSKLYSGSGIHSLSELNPKSTQTLS |
| Ga0168698_1049101 | 3300029234 | Host-Associated | RIDPPMEPEQERLSKLYSGSGIHSLTELNPNFMEANQ |
| Ga0168698_1089955 | 3300029234 | Host-Associated | RIDPPMEPEQERLSKLYSGSGIHSLSELNPKSTQTLS |
| Ga0169721_1068506 | 3300029236 | Human Host-Associated | FESLFLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNSNTI |
| Ga0168690_10078424 | 3300029249 | Host-Associated | LLAEFCPFRIDPPMEPEQERLFKLYSGSGIQSLPELNPN |
| Ga0168699_10041721 | 3300029253 | Host-Associated | PFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNFMEANQ |
| Ga0168827_1011531 | 3300029256 | Host-Associated | LLLAEFYPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPKSTQTLS |
| Ga0242753_10178420 | 3300029315 | Human Feces | NFESLLLAEFCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPNLIKSQFYAPSHHP |
| Ga0242844_1070833 | 3300029325 | Human Feces | ICRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0243782_1107454 | 3300029332 | Human Feces | VSNFESLLLAEFYPFRIDPPMEPEQERLFKLYSGSGIHSLPELNPNLLQNIHRM |
| Ga0243760_1115114 | 3300029333 | Human Feces | LAEFYPFRIDPPMEPEQERLFKLYSGSGIHSLPELNPNLLQNIHRM |
| Ga0243762_1101301 | 3300029335 | Human Feces | SNFESLLLAEFYPFRIDPPMEPEQERLFKLYSGSGIHSLPELNPN |
| Ga0243762_1158221 | 3300029335 | Human Feces | VCRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPKSTQTLS |
| Ga0243752_1022221 | 3300029336 | Human Feces | SNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0242823_10043751 | 3300029339 | Human Feces | VSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPK |
| Ga0242823_10151371 | 3300029339 | Human Feces | VSNFESLLLAEFCPFRIDPPMEPEQEHLSKLYSGSGIHSLSELNPKSN |
| Ga0243725_10283784 | 3300029343 | Human Feces | FESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNYADSIS |
| Ga0243800_100055203 | 3300029348 | Human Feces | LLLAEFCPFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPN |
| Ga0243859_1009801 | 3300029350 | Human Feces | GICRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPN |
| Ga0243797_1001291 | 3300029356 | Human Feces | AEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0243818_10003491 | 3300029358 | Human Feces | EFCPFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPKSI |
| Ga0243815_10286231 | 3300029361 | Human Feces | CRVSNFESLLLAEFCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPN |
| Ga0243960_1300321 | 3300029369 | Human Feces | GVCRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPK |
| Ga0243957_1271941 | 3300029370 | Human Feces | ESLFLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNLI |
| Ga0243963_1030161 | 3300029372 | Human Feces | EFCPFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPNLI |
| Ga0243914_10136927 | 3300029373 | Human Feces | NFESLFLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPKLF |
| Ga0243914_1141593 | 3300029373 | Human Feces | SLLLAEFCPFRIDPPMKPEQERLSKLYSGPGIQRLPELNPKQN |
| Ga0243934_10008961 | 3300029375 | Human Feces | CPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNLNL |
| Ga0243983_10027681 | 3300029384 | Human Feces | GVCRVSNFESLLLAEFCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPN |
| Ga0243985_10247671 | 3300029385 | Human Feces | IDPPMEPEQERLSKLYSGSGIHSLPELNPNNPYSPHL |
| Ga0242750_1051321 | 3300029399 | Human Feces | FESLLLAEFCPFRIDPPMEPEQEHLSKLYSGSGIHSLSELNPKSN |
| Ga0243962_10067835 | 3300029402 | Human Feces | SLLLAEFYPFRIDPPMEPEQERLFKLYSGSGIHSFPELNPN |
| Ga0243962_1021141 | 3300029402 | Human Feces | GVCRVSNFESLLLAEFCPFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPN |
| Ga0243962_1091321 | 3300029402 | Human Feces | CPFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPNLI |
| Ga0243959_1282521 | 3300029405 | Human Feces | LAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNLI |
| Ga0243764_1009991 | 3300029407 | Human Feces | FCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPN |
| Ga0243861_100116104 | 3300029411 | Human Feces | FCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0243861_1043831 | 3300029411 | Human Feces | SLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPK |
| Ga0243861_1105315 | 3300029411 | Human Feces | EFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPN |
| Ga0243861_1118901 | 3300029411 | Human Feces | LLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLMN |
| Ga0243915_10172922 | 3300029412 | Human Feces | SNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPKLF |
| Ga0243798_1015581 | 3300029414 | Human Feces | CPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPKSTQTLS |
| Ga0243913_1003731 | 3300029419 | Human Feces | NFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0243802_1015121 | 3300029423 | Human Feces | PNAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0242789_10071243 | 3300029426 | Human Feces | CRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNSK |
| Ga0242789_10121422 | 3300029426 | Human Feces | NFESLLLAEFYPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0242788_1013371 | 3300029428 | Human Feces | RVSNFESLLLAEFYPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0242788_1027221 | 3300029428 | Human Feces | SLLLAEFCPFRIDPPMEPEQEHLSKLYSVSGIHSLPELNPD |
| Ga0243922_1017441 | 3300029430 | Human Feces | RVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0243758_10289621 | 3300029431 | Human Feces | ESLLLAEFCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPKQI |
| Ga0243761_10118711 | 3300029433 | Human Feces | CRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNYADSIS |
| Ga0243761_10274121 | 3300029433 | Human Feces | CRVSTFESLLLAEFCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPKQI |
| Ga0243855_10035331 | 3300029434 | Human Feces | LLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0242826_10123764 | 3300029437 | Human Feces | GVCRVSNFESLLLAEFYPFRIDPPMKPEQERLFKLYSGSGIHSLPELNPNLLQNIHRM |
| Ga0244146_1012531 | 3300029476 | Human Fecal | SNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPN |
| Ga0244146_1132521 | 3300029476 | Human Fecal | CRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNTI |
| Ga0244079_1052851 | 3300029480 | Human Fecal | LAEFCPFRIDPPMEPEQERLFKLYSGSGIQSLPELNPN |
| Ga0244179_1035401 | 3300029487 | Human Fecal | PFRIDPPMEPEQERLFKLYSGSGIQSLPELNPNLI |
| Ga0244072_1184321 | 3300029488 | Human Fecal | LLLAEFCPFRIDPPMEPEQERLFKLYSGSGIQSLPELNPNLI |
| Ga0244830_1086263 | 3300029508 | Human Fecal | LLLAEFCPFRIDPPMEPEQERLFKLYSGSGIHSLPELNPN |
| Ga0244809_1009871 | 3300029511 | Human Fecal | LAEFYPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNCATVVSFQ |
| Ga0244809_1026311 | 3300029511 | Human Fecal | VCRVSNFESLLLAEFCPFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPNLI |
| Ga0244799_1286711 | 3300029516 | Human Fecal | VCRVSNFESLLLAEFCPFRIDPPIEPEQEHLSKLYSGSGIHSLSELNPKSTQTLS |
| Ga0244840_10034664 | 3300029519 | Human Fecal | LLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNFMEANQ |
| Ga0244840_1005061 | 3300029519 | Human Fecal | CRVSNFESLLLAEFCPFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPN |
| Ga0244801_1083675 | 3300029520 | Human Fecal | SNFESLLLAEFCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPNCATVISFQ |
| Ga0244833_1029489 | 3300029521 | Human Fecal | CRVSNFESLLLAEFCPFRIDPPMEPEQERLFKLYSGSGIQSLPELNPN |
| Ga0244833_1085881 | 3300029521 | Human Fecal | SNFESLLLAEFCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPNLLQNIHRM |
| Ga0244962_10031373 | 3300029530 | Human Fecal | VCRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLTELNPNFMEANQ |
| Ga0244962_10032171 | 3300029530 | Human Fecal | CRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPKLNL |
| Ga0244962_1009701 | 3300029530 | Human Fecal | EFCPFRIDPPMEPEQERLFKLYSGSGIQSLPELNPN |
| Ga0244962_1035481 | 3300029530 | Human Fecal | FESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPYPL |
| Ga0244920_1041951 | 3300029531 | Human Fecal | LAEFCPFRIDPPMEPEQERLFKLYSGSGIQSLPELNPNLI |
| Ga0244989_1077834 | 3300029543 | Human Fecal | FESLLLAEFCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPNLLQNIHRM |
| Ga0244975_1052116 | 3300029556 | Human Fecal | FESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPKSTQTLS |
| Ga0244922_1107756 | 3300029571 | Human Fecal | GVCRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNYADSIS |
| Ga0244922_1242891 | 3300029571 | Human Fecal | SNFESLLLAEFCPFRIDPPMEPEQEHLSKLYSGSGIHSLPELNSNFMETNQ |
| Ga0245099_100636010 | 3300029590 | Human Fecal | PFRIDPPMEPEQERLFKLYSGSGIHSLPELNPKLF |
| Ga0245135_10203313 | 3300029593 | Human Fecal | RRVSNFESLLLAEFYPFRIDPPMEPEQERLSKLYSSSGIHSLSELNPKQI |
| Ga0242758_10101115 | 3300029633 | Human Feces | VSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0245252_1035991 | 3300029713 | Human Fecal | LAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPKQI |
| Ga0245259_1239752 | 3300029735 | Human Fecal | CRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPNLI |
| Ga0245259_1340461 | 3300029735 | Human Fecal | RIDPPMEPEQERLSKLYSGSGIHSLPELNPNFMEANQ |
| Ga0168701_10067822 | 3300029751 | Host-Associated | LLLAEFCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPNCATVVSFQ |
| Ga0168701_1037404 | 3300029751 | Host-Associated | LLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPNLNL |
| Ga0242840_10079744 | 3300029756 | Human Feces | FLRGKIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0242784_1027771 | 3300029758 | Human Feces | CRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPN |
| Ga0243857_10035752 | 3300029761 | Human Feces | ESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0243863_1029241 | 3300029769 | Human Feces | NFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPK |
| Ga0243759_1249593 | 3300029776 | Human Feces | EFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPKSTQTLS |
| Ga0243715_10639241 | 3300029777 | Human Feces | LAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0243763_10157991 | 3300029785 | Human Feces | SNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPKSTQTLS |
| Ga0243817_10117371 | 3300029786 | Human Feces | ESLLLAEFYPFRIDPPMKPEQERLFKLYSGSGIHSLPELNPNLLQNIHRM |
| Ga0243817_10186931 | 3300029786 | Human Feces | AEFCPFRIDPPMEPEQEHLSKLYSGSGIHSLPELNPKSI |
| Ga0244882_10215671 | 3300029815 | Human Fecal | CRVSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPKSI |
| Ga0245024_10035579 | 3300029819 | Human Fecal | AEFCPFRIDPPMEPEQERLFKLYSGSGIQSLPELNPNLI |
| Ga0245310_1111281 | 3300029861 | Human Fecal | FCPFRIDPPMEPEQERLFKLYSGSGIHSLPELNPKSI |
| Ga0245310_1189792 | 3300029861 | Human Fecal | VSNFESLLLAEFCPFRIDPPMEPEQERLFKLYSGSGIQSLPELNSKLNPNLFQRI |
| ⦗Top⦘ |