| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029428 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133095 | Gp0281904 | Ga0242788 |
| Sample Name | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_3_stool_1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 210206419 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 6 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Baltimore | |||||||
| Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056309 | Metagenome | 137 | N |
| F070093 | Metagenome | 123 | N |
| F078822 | Metagenome | 116 | N |
| F088920 | Metagenome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0242788_101243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 26428 | Open in IMG/M |
| Ga0242788_101257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 26026 | Open in IMG/M |
| Ga0242788_101337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 24209 | Open in IMG/M |
| Ga0242788_101475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 21415 | Open in IMG/M |
| Ga0242788_102562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 10702 | Open in IMG/M |
| Ga0242788_102722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 9956 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0242788_101243 | Ga0242788_10124323 | F078822 | FPNAFLKAFHPHAVRFPAAFLLVHRFYLAFEELLSCATAYL |
| Ga0242788_101257 | Ga0242788_10125710 | F056309 | VXXXXPSLSVVPLLLGDSDSLSVSYGYGMEPEQEALSIVSFKD |
| Ga0242788_101337 | Ga0242788_1013371 | F070093 | RVSNFESLLLAEFYPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0242788_101475 | Ga0242788_10147518 | F078822 | SFPNAFLKAFHPHAVRSPAAFLLVHRFYLAFEELLSCATAYL |
| Ga0242788_102562 | Ga0242788_10256210 | F088920 | LFVKWNPKNHHFIFLFLAFFSFVSANLHHYPAFWAGLILHLILHFSQKVAIFAPKRAILLIFVPTLFFACLAAFSLHTSPKISGQTSLHQPWLSPYCLFKD |
| Ga0242788_102722 | Ga0242788_1027221 | F070093 | SLLLAEFCPFRIDPPMEPEQEHLSKLYSVSGIHSLPELNPD |
| ⦗Top⦘ |