Basic Information | |
---|---|
IMG/M Taxon OID | 3300029315 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133095 | Gp0281869 | Ga0242753 |
Sample Name | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 001_6_5_stool_1 |
Sequencing Status | Permanent Draft |
Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 157316190 |
Sequencing Scaffolds | 5 |
Novel Protein Genes | 6 |
Associated Families | 5 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Mediterraneibacter → [Ruminococcus] torques | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Baltimore | |||||||
Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056309 | Metagenome | 137 | N |
F059106 | Metagenome | 134 | N |
F070093 | Metagenome | 123 | N |
F073656 | Metagenome | 120 | N |
F089591 | Metagenome | 109 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0242753_100166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Mediterraneibacter → [Ruminococcus] torques | 96991 | Open in IMG/M |
Ga0242753_100257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 78828 | Open in IMG/M |
Ga0242753_101784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 18210 | Open in IMG/M |
Ga0242753_102752 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 11181 | Open in IMG/M |
Ga0242753_105078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4835 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0242753_100166 | Ga0242753_10016696 | F059106 | WKIRVILLQKFVWIVDLKVREHLTEYLKKDIKYHRATTGVHV |
Ga0242753_100257 | Ga0242753_1002571 | F056309 | VKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
Ga0242753_101784 | Ga0242753_10178420 | F070093 | NFESLLLAEFCPFRIDPPMEPEQEHLFKLYSGSGIHSLPELNPNLIKSQFYAPSHHP |
Ga0242753_102752 | Ga0242753_1027526 | F073656 | MTMEQDQEQMQGALYVAVDDGNKIIAMERSRRGDEGFRALLDEFTDYAANRGEIPSVLFFDIRTTDAALLPRIEAAEHNYLLDPSTVTEKLDIRHAVTLKDLLYCYKYDLDPLAEGNCGNMLSTKADYRQFRNEGLPPVAREDLRRCRAVETERGTVLFTQEPDGREACERYMQHHADCFFDPDLGVETLRVYEVEADPDGFWDKVNPQVLPTAGGMMWVPEHPFVDAEVLRRGYCLKEYDMRATADNFWTFVNPQHGENLYVSNGIRDLTGLQIIMQRGYGYLMQNAERYWNREFVFRNGFDNIERKYASDLSDEGRAAKREEQYNLAAYILDRKFPIRRRPSSEIPPMQAEGIRTFRNFDAINLLFRPDKLLEAYQRRRDEPVRGAEFHLKRH |
Ga0242753_105078 | Ga0242753_1050784 | F056309 | LRRMPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
Ga0242753_117876 | Ga0242753_1178762 | F089591 | MTIQEAYLRSLQKNEQNLANGGIKLDPGRFVLLFNEAQDRLVKYYLNRKDDETIRSIQTLLVYWKSLNKINHIDDPESTSFGLPDDYLWFSNIKGSFSYNGCEIGDFVMWEAKNENVHELLGDDNNKPSFDYRETFYTIGDGKVVVYEDGFLTDEVRMTYYRNPVRVDLAGYINAAGDRSTDIDPELPDPLVEEILDMVAKQFNLNENELSRYRMDKDNVASFK |
⦗Top⦘ |