| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029411 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133117 | Gp0283022 | Ga0243861 |
| Sample Name | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_13_stool_2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 171049157 |
| Sequencing Scaffolds | 8 |
| Novel Protein Genes | 8 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 5 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
| All Organisms → Viruses → Predicted Viral | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Baltimore | |||||||
| Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032286 | Metagenome / Metatranscriptome | 180 | Y |
| F056309 | Metagenome | 137 | N |
| F070093 | Metagenome | 123 | N |
| F071325 | Metagenome | 122 | N |
| F097493 | Metagenome | 104 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0243861_100116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 126144 | Open in IMG/M |
| Ga0243861_100733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 35291 | Open in IMG/M |
| Ga0243861_101473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 15649 | Open in IMG/M |
| Ga0243861_104383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 4823 | Open in IMG/M |
| Ga0243861_107843 | All Organisms → Viruses → Predicted Viral | 2743 | Open in IMG/M |
| Ga0243861_110531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2078 | Open in IMG/M |
| Ga0243861_111890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1855 | Open in IMG/M |
| Ga0243861_132722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 718 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0243861_100116 | Ga0243861_100116104 | F070093 | FCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
| Ga0243861_100733 | Ga0243861_1007331 | F071325 | SIFKVLLALLSDSSIIISKVVLFVKHFFDIFLSLPNAFLKAFHPHAVRFPAAFLLVHRFYLAFEELLSCATAYL |
| Ga0243861_101473 | Ga0243861_10147315 | F056309 | CLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243861_104383 | Ga0243861_1043831 | F070093 | SLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPK |
| Ga0243861_107843 | Ga0243861_1078432 | F097493 | MYKFYSKNGTAQFYERGVEIDGTVYGIRTDSDILRIKRSVVNSKFAESEEDFDMNVEIAKIQHMDITLEQPTSEQLSQIQAKTYNSMTELKQHVQSIMNGELTQDEINAMLLLRIAEMEVAITNEQTTN |
| Ga0243861_110531 | Ga0243861_1105315 | F070093 | EFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPN |
| Ga0243861_111890 | Ga0243861_1118901 | F070093 | LLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLMN |
| Ga0243861_132722 | Ga0243861_1327221 | F032286 | MVKWICQIVTPVRHRALVFNTRLFAGNAADDTLVTGGTFRFCRLVCLCVKRRNIILNGKRRSLLNSTLFRADNRTEQKTISPFSLALIFTFDFAALSERRSCPEDRSRRFVPVGTLTLSRSWRLLRRGTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKIADFHAYGQDRKRAEI |
| ⦗Top⦘ |